Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	64843
Gene name	ISL LIM homeobox 2
Gene symbol	ISL2
Synonyms (NCBI Gene)	-
Chromosome	15
Chromosome location	15q24.3

Show/Hide all (60)

miRTarBase ID	miRNA	Experiments	Reference
MIRT490294	hsa-miR-7160-3p	PAR-CLIP	23592263
MIRT490293	hsa-miR-7706	PAR-CLIP	23592263
MIRT490292	hsa-miR-1252-5p	PAR-CLIP	23592263
MIRT490291	hsa-miR-3195	PAR-CLIP	23592263
MIRT490289	hsa-miR-4533	PAR-CLIP	23592263
MIRT490290	hsa-miR-4747-5p	PAR-CLIP	23592263
MIRT490288	hsa-miR-5196-5p	PAR-CLIP	23592263
MIRT490287	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT490286	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT490285	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT490284	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT490283	hsa-miR-4271	PAR-CLIP	23592263
MIRT490282	hsa-miR-4725-3p	PAR-CLIP	23592263
MIRT490281	hsa-miR-6780b-5p	PAR-CLIP	23592263
MIRT490280	hsa-miR-6724-5p	PAR-CLIP	23592263
MIRT490294	hsa-miR-7160-3p	PAR-CLIP	23592263
MIRT490293	hsa-miR-7706	PAR-CLIP	23592263
MIRT490292	hsa-miR-1252-5p	PAR-CLIP	23592263
MIRT490291	hsa-miR-3195	PAR-CLIP	23592263
MIRT490289	hsa-miR-4533	PAR-CLIP	23592263
MIRT490290	hsa-miR-4747-5p	PAR-CLIP	23592263
MIRT490288	hsa-miR-5196-5p	PAR-CLIP	23592263
MIRT490287	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT490286	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT490285	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT490284	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT490283	hsa-miR-4271	PAR-CLIP	23592263
MIRT490282	hsa-miR-4725-3p	PAR-CLIP	23592263
MIRT490281	hsa-miR-6780b-5p	PAR-CLIP	23592263
MIRT490280	hsa-miR-6724-5p	PAR-CLIP	23592263
MIRT1072715	hsa-miR-1277	CLIP-seq
MIRT1072716	hsa-miR-3150b-3p	CLIP-seq
MIRT1072717	hsa-miR-3659	CLIP-seq
MIRT1072718	hsa-miR-3921	CLIP-seq
MIRT1072719	hsa-miR-3960	CLIP-seq
MIRT1072720	hsa-miR-4270	CLIP-seq
MIRT1072721	hsa-miR-4326	CLIP-seq
MIRT1072722	hsa-miR-4424	CLIP-seq
MIRT1072723	hsa-miR-4441	CLIP-seq
MIRT1072724	hsa-miR-4653-5p	CLIP-seq
MIRT1072725	hsa-miR-4658	CLIP-seq
MIRT1072726	hsa-miR-4663	CLIP-seq
MIRT1072727	hsa-miR-4682	CLIP-seq
MIRT1072728	hsa-miR-4758-5p	CLIP-seq
MIRT1072729	hsa-miR-4784	CLIP-seq
MIRT1072730	hsa-miR-574-5p	CLIP-seq
MIRT2017903	hsa-miR-1273f	CLIP-seq
MIRT2017904	hsa-miR-3127-3p	CLIP-seq
MIRT2017905	hsa-miR-3667-3p	CLIP-seq
MIRT2017906	hsa-miR-3679-3p	CLIP-seq
MIRT1072722	hsa-miR-4424	CLIP-seq
MIRT2017907	hsa-miR-4446-5p	CLIP-seq
MIRT1072727	hsa-miR-4682	CLIP-seq
MIRT2249702	hsa-miR-375	CLIP-seq
MIRT1072720	hsa-miR-4270	CLIP-seq
MIRT2249703	hsa-miR-4284	CLIP-seq
MIRT1072723	hsa-miR-4441	CLIP-seq
MIRT2249704	hsa-miR-4492	CLIP-seq
MIRT2249705	hsa-miR-4498	CLIP-seq
MIRT2249706	hsa-miR-762	CLIP-seq

Show/Hide all (29)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0000987	Function	Cis-regulatory region sequence-specific DNA binding	IBA
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	ISS	17091338
GO:0005515	Function	Protein binding	IPI	27820671, 28514442, 32296183, 33961781, 35140242
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IC	17091338
GO:0005634	Component	Nucleus	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0007409	Process	Axonogenesis	IBA
GO:0021520	Process	Spinal cord motor neuron cell fate specification	IEA
GO:0021524	Process	Visceral motor neuron differentiation	IEA
GO:0030182	Process	Neuron differentiation	IEA
GO:0031290	Process	Retinal ganglion cell axon guidance	IEA
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0045665	Process	Negative regulation of neuron differentiation	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0048663	Process	Neuron fate commitment	IEA
GO:0048665	Process	Neuron fate specification	IBA
GO:0048665	Process	Neuron fate specification	IEA
GO:0048666	Process	Neuron development	IEA
GO:0048666	Process	Neuron development	TAS	9452425
GO:0048935	Process	Peripheral nervous system neuron development	TAS	20096094
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

MIM	HGNC	e!Ensembl
609481	18524	ENSG00000159556

Q96A47

Protein name

Insulin gene enhancer protein ISL-2 (Islet-2)

Protein function

Transcriptional factor that defines subclasses of motoneurons that segregate into columns in the spinal cord and select distinct axon pathways.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00412	LIM	27 → 85	LIM domain	Domain
PF00412	LIM	89 → 145	LIM domain	Domain
PF00046	Homeodomain	192 → 248	Homeodomain	Domain

Sequence

MVDIIFHYPFLGAMGDHSKKKPGTAMCVGCGSQIHDQFILRVSPDLEWHAACLKCAECSQ
YLDETCTCFVRDGKTYCKRDYVRLFGIKCAKCQVGFSSSDLVMRARDSVYHIECFRCSVC
SRQLLPGDEFSLREHELLCRADHGLLLERAAAGSPRSPGPLPGARGLHLPDAGSGRQPAL
RPHVHKQTEKTTRVRTVLNEKQLHTLRTCYAANPRPDALMKEQLVEMTGLSPRVIRVWFQ
NKRCKDKKKSILMKQLQQQQHSDKTSLQGLTGTPLVAGSPIRHENAVQGSAVEVQTYQPP
WKALSEFALQSDLDQPAFQQLVSFSESGSLGNSSGSDVTSLSSQLPDTPNSMVPSPVET

Sequence length

359

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIVERTICULAR DISEASES	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SLEEP APNEA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (4)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	35508175	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diverticular Bleeding	Diverticular Bleeding	CTD_human_DG	30177863		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diverticular Diseases	Diverticular Diseases	CTD_human_DG	30177863		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	35508175	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

ISL2 (ISL LIM homeobox 2)