Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	64838
Gene name	Fibronectin type III domain containing 4
Gene symbol	FNDC4
Synonyms (NCBI Gene)	FRCP1
Chromosome	2
Chromosome location	2p23.3

Show/Hide all (93)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022409	hsa-miR-124-3p	Microarray	18668037
MIRT025717	hsa-miR-7-5p	Sequencing	20371350
MIRT1000573	hsa-miR-130a	CLIP-seq
MIRT1000574	hsa-miR-130b	CLIP-seq
MIRT1000575	hsa-miR-301a	CLIP-seq
MIRT1000576	hsa-miR-301b	CLIP-seq
MIRT1000577	hsa-miR-3198	CLIP-seq
MIRT1000578	hsa-miR-3617	CLIP-seq
MIRT1000579	hsa-miR-3666	CLIP-seq
MIRT1000580	hsa-miR-4295	CLIP-seq
MIRT1000581	hsa-miR-4309	CLIP-seq
MIRT1000582	hsa-miR-454	CLIP-seq
MIRT1000583	hsa-miR-4671-3p	CLIP-seq
MIRT1000584	hsa-miR-641	CLIP-seq
MIRT1000585	hsa-miR-7	CLIP-seq
MIRT2534409	hsa-miR-1178	CLIP-seq
MIRT2534410	hsa-miR-1225-5p	CLIP-seq
MIRT2534411	hsa-miR-1237	CLIP-seq
MIRT2534412	hsa-miR-125a-3p	CLIP-seq
MIRT2534413	hsa-miR-128	CLIP-seq
MIRT2534414	hsa-miR-1302	CLIP-seq
MIRT2534415	hsa-miR-149	CLIP-seq
MIRT2534416	hsa-miR-203	CLIP-seq
MIRT2534417	hsa-miR-2355-5p	CLIP-seq
MIRT2534418	hsa-miR-2392	CLIP-seq
MIRT2534419	hsa-miR-27a	CLIP-seq
MIRT2534420	hsa-miR-27b	CLIP-seq
MIRT2534421	hsa-miR-296-5p	CLIP-seq
MIRT2534422	hsa-miR-3064-5p	CLIP-seq
MIRT2534423	hsa-miR-3122	CLIP-seq
MIRT2534424	hsa-miR-3194-3p	CLIP-seq
MIRT2534425	hsa-miR-3202	CLIP-seq
MIRT2534426	hsa-miR-331-3p	CLIP-seq
MIRT2534427	hsa-miR-3605-5p	CLIP-seq
MIRT2534428	hsa-miR-3649	CLIP-seq
MIRT2534429	hsa-miR-3675-5p	CLIP-seq
MIRT2534430	hsa-miR-3690	CLIP-seq
MIRT2534431	hsa-miR-3913-5p	CLIP-seq
MIRT2534432	hsa-miR-3978	CLIP-seq
MIRT2534433	hsa-miR-4298	CLIP-seq
MIRT2534434	hsa-miR-4308	CLIP-seq
MIRT2534435	hsa-miR-4324	CLIP-seq
MIRT2534436	hsa-miR-4428	CLIP-seq
MIRT2534437	hsa-miR-4522	CLIP-seq
MIRT2534438	hsa-miR-4533	CLIP-seq
MIRT2534439	hsa-miR-4539	CLIP-seq
MIRT2534440	hsa-miR-4650-5p	CLIP-seq
MIRT2534441	hsa-miR-4655-5p	CLIP-seq
MIRT2534442	hsa-miR-4685-5p	CLIP-seq
MIRT2534443	hsa-miR-4688	CLIP-seq
MIRT2534444	hsa-miR-4714-5p	CLIP-seq
MIRT2534445	hsa-miR-4724-3p	CLIP-seq
MIRT2534446	hsa-miR-4726-3p	CLIP-seq
MIRT2534447	hsa-miR-4733-5p	CLIP-seq
MIRT2534448	hsa-miR-4794	CLIP-seq
MIRT2534449	hsa-miR-552	CLIP-seq
MIRT2534450	hsa-miR-583	CLIP-seq
MIRT2534451	hsa-miR-760	CLIP-seq
MIRT2534452	hsa-miR-767-3p	CLIP-seq
MIRT2534409	hsa-miR-1178	CLIP-seq
MIRT2534410	hsa-miR-1225-5p	CLIP-seq
MIRT2534411	hsa-miR-1237	CLIP-seq
MIRT2534413	hsa-miR-128	CLIP-seq
MIRT2534415	hsa-miR-149	CLIP-seq
MIRT2534417	hsa-miR-2355-5p	CLIP-seq
MIRT2534418	hsa-miR-2392	CLIP-seq
MIRT2534419	hsa-miR-27a	CLIP-seq
MIRT2534420	hsa-miR-27b	CLIP-seq
MIRT2534422	hsa-miR-3064-5p	CLIP-seq
MIRT2534424	hsa-miR-3194-3p	CLIP-seq
MIRT2534425	hsa-miR-3202	CLIP-seq
MIRT2534426	hsa-miR-331-3p	CLIP-seq
MIRT2534427	hsa-miR-3605-5p	CLIP-seq
MIRT2534430	hsa-miR-3690	CLIP-seq
MIRT2534432	hsa-miR-3978	CLIP-seq
MIRT2534434	hsa-miR-4308	CLIP-seq
MIRT2534435	hsa-miR-4324	CLIP-seq
MIRT2534436	hsa-miR-4428	CLIP-seq
MIRT2534437	hsa-miR-4522	CLIP-seq
MIRT2534438	hsa-miR-4533	CLIP-seq
MIRT2534439	hsa-miR-4539	CLIP-seq
MIRT2534440	hsa-miR-4650-5p	CLIP-seq
MIRT2534441	hsa-miR-4655-5p	CLIP-seq
MIRT2534442	hsa-miR-4685-5p	CLIP-seq
MIRT2534443	hsa-miR-4688	CLIP-seq
MIRT2534444	hsa-miR-4714-5p	CLIP-seq
MIRT2534445	hsa-miR-4724-3p	CLIP-seq
MIRT2534446	hsa-miR-4726-3p	CLIP-seq
MIRT2534447	hsa-miR-4733-5p	CLIP-seq
MIRT2534448	hsa-miR-4794	CLIP-seq
MIRT2534450	hsa-miR-583	CLIP-seq
MIRT2534451	hsa-miR-760	CLIP-seq
MIRT2534452	hsa-miR-767-3p	CLIP-seq

Show/Hide all (11)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IEA
GO:0005615	Component	Extracellular space	ISS
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005783	Component	Endoplasmic reticulum	ISS
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0016020	Component	Membrane	IEA
GO:0050728	Process	Negative regulation of inflammatory response	IEA
GO:0050728	Process	Negative regulation of inflammatory response	ISS
GO:0071559	Process	Response to transforming growth factor beta	IEP	27066907

MIM	HGNC	e!Ensembl
611905	20239	ENSG00000115226

Q9H6D8

Protein name

Fibronectin type III domain-containing protein 4 (Fibronectin type III repeat-containing protein 1) [Cleaved into: Soluble FNDC4 (sFNDC4)]

Protein function

[Soluble FNDC4]: Has anti-inflammatory properties. In the colon, acts on macrophages to down-regulate inflammation. May suppress osteoclastogenesis and mature osteoclast resorptive function. In white adipose tissue, decreases local inflammation,

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00041	fn3	48 → 130	Fibronectin type III domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in the liver and the brain, including in the cortex, hypothalamus and hippocampus (PubMed:34016966). Also expressed in adipose tissue (PubMed:34016966). {ECO:0000269|PubMed:34016966}.

Sequence

MPSGCHSSPPSGLRGDMASLVPLSPYLSPTVLLLVSCDLGFVRADRPPSPVNVTVTHLRA
NSATVSWDVPEGNIVIGYSISQQRQNGPGQRVIREVNTTTRACALWGLAEDSDYTVQVRS
IGLRGESPPGPRVHFRTLKGSDRLPSNSSSPGDITVEGLDGERPLQTGEVVIIVVVLLMW
AAVIGLFCRQYDIIKDNDSNNNPKEKGKGPEQSPQGRPVGTRQKKSPSINTIDV

Sequence length

234

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
LIPIDOSES	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIPOIDOSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (16)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	38181585	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis, Gouty	Gouty arthritis	GWASDB_DG	20884846, 23263486		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	34418326	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	27066907, 29977911		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	39173437	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	29787756		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fuchs' Endothelial Dystrophy	Fuchs endothelial dystrophy	Pubtator	28726551	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gout	Gout	GWASDB_DG	20884846, 23263486		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	35752749	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	29787756		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	27066907		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lipoidosis	Lipoidosis	CTD_human_DG	15342952, 16919414, 17175557		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Diseases	Liver disease	Pubtator	39173437	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	39173437	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	39173437	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	35752749	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

FNDC4 (fibronectin type III domain containing 4)