CYP3A43 (cytochrome P450 family 3 subfamily A member 43)

Gene

• Entrez ID: 64816
• Gene name: Cytochrome P450 family 3 subfamily A member 43
• Gene symbol: CYP3A43
• Synonyms (NCBI Gene): -
• Chromosome: 7
• Chromosome location: 7q22.1
• Summary: This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. The encoded protei

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT921536	hsa-miR-1276	CLIP-seq
MIRT921537	hsa-miR-4311	CLIP-seq
MIRT921538	hsa-miR-583	CLIP-seq
MIRT921539	hsa-miR-636	CLIP-seq
MIRT921540	hsa-miR-653	CLIP-seq
MIRT921541	hsa-miR-1286	CLIP-seq
MIRT921542	hsa-miR-200b	CLIP-seq
MIRT921543	hsa-miR-200c	CLIP-seq
MIRT921544	hsa-miR-3617	CLIP-seq
MIRT921545	hsa-miR-369-3p	CLIP-seq
MIRT921546	hsa-miR-374a	CLIP-seq
MIRT921547	hsa-miR-374b	CLIP-seq
MIRT921548	hsa-miR-3913-3p	CLIP-seq
MIRT921549	hsa-miR-429	CLIP-seq
MIRT921550	hsa-miR-4517	CLIP-seq
MIRT921551	hsa-miR-4722-5p	CLIP-seq
MIRT921552	hsa-miR-4793-5p	CLIP-seq
MIRT921553	hsa-miR-4795-3p	CLIP-seq
MIRT921554	hsa-miR-641	CLIP-seq
MIRT921555	hsa-miR-7	CLIP-seq
MIRT921556	hsa-miR-889	CLIP-seq
MIRT2436753	hsa-miR-4457	CLIP-seq
MIRT2436754	hsa-miR-4775	CLIP-seq
MIRT2436755	hsa-miR-513b	CLIP-seq
MIRT2436756	hsa-miR-590-3p	CLIP-seq
MIRT2436753	hsa-miR-4457	CLIP-seq
MIRT2436754	hsa-miR-4775	CLIP-seq
MIRT2436755	hsa-miR-513b	CLIP-seq
MIRT2436756	hsa-miR-590-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004497	Function	Monooxygenase activity	IEA
GO:0004497	Function	Monooxygenase activity	ISS
GO:0004497	Function	Monooxygenase activity	TAS
GO:0005506	Function	Iron ion binding	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0008202	Process	Steroid metabolic process	IBA
GO:0016020	Component	Membrane	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016705	Function	Oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen	IEA
GO:0016712	Function	Oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen	IEA
GO:0020037	Function	Heme binding	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0050649	Function	Testosterone 6-beta-hydroxylase activity	IBA
GO:0070989	Process	Oxidative demethylation	IBA
GO:0101020	Function	Estrogen 16-alpha-hydroxylase activity	IBA
GO:1903604	Process	Cytochrome metabolic process	TAS

Other IDs

• MIM: 606534
• HGNC: 17450
• e!Ensembl: ENSG00000021461

Protein

• UniProt ID: Q9HB55
• Protein name: Cytochrome P450 3A43 (EC 1.14.14.1)
• Protein function: Exhibits low testosterone 6-beta-hydroxylase activity.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00067	p450	38 → 493	Cytochrome P450	Domain

• Tissue specificity: TISSUE SPECIFICITY: Highest expression level in prostate. Also expressed in liver, kidney, pancreas, fetal liver and fetal skeletal muscle. {ECO:0000269|PubMed:11160876, ECO:0000269|PubMed:11243885}.
• Sequence:

  MDLIPNFAMETWVLVATSLVLLYIYGTHSHKLFKKLGIPGPTPLPFLGTILFYLRGLWNF
  DRECNEKYGEMWGLYEGQQPMLVIMDPDMIKTVLVKECYSVFTNQMPLGPMGFLKSALSF
  AEDEEWKRIRTLLSPAFTSVKFKEMVPIISQCGDMLVRSLRQEAENSKSINLKDFFGAYT
  MDVITGTLFGVNLDSLNNPQDPFLKNMKKLLKLDFLDPFLLLISLFPFLTPVFEALNIGL
  FPKDVTHFLKNSIERMKESRLKDKQKHRVDFFQQMIDSQNSKETKSHKALSDLELVAQSI
  IIIFAAYDTTSTTLPFIMYELATHPDVQQKLQEEIDAVLPNKAPVTYDALVQMEYLDMVV
  NETLRLFPVVSRVTRVCKKDIEINGVFIPKGLAVMVPIYALHHDPKYWTEPEKFCPERFS
  KKNKDSIDLYRYIPFGAGPRNCIGMRFALTNIKLAVIRALQNFSFKPCKETQIPLKLDNL
  PILQPEKPIVLKVHLRDGITSGP

• Sequence length: 503

Pathways

KEGG:

Chemical carcinogenesis - DNA adducts

Reactome:

Miscellaneous substrates
Xenobiotics

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
AUTISM SPECTRUM DISORDER	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEPHROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	18566991		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	20715157		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	20715157	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	36613552	Associate	★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	38181271	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	36613552	Inhibit	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	20715157		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	15548719, 15894682, 20621111, 25111073, 25337833, 26585945, 27164191		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	15894682		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	20715157		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	18566991, 20715157		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	36613552	Associate	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	15548719, 15894682, 25111073, 25337833, 26585945, 27164191		★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	18566991, 21493872	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	15894682		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	15894682		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	18566991, 21493872, 25111073, 25337833, 27164191	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations