Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	6480
Gene name	ST6 beta-galactoside alpha-2,6-sialyltransferase 1
Gene symbol	ST6GAL1
Synonyms (NCBI Gene)	CDw75SIAT1ST6GalIST6N
Chromosome	3
Chromosome location	3q27.3
Summary	This gene encodes a member of glycosyltransferase family 29. The encoded protein is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. The protein, which is normally found in the

161

Show/Hide all (161)

miRTarBase ID	miRNA	Experiments	Reference
MIRT006076	hsa-miR-492	MicroarrayqRT-PCR	21319197
MIRT006076	hsa-miR-492	MicroarrayqRT-PCR	21319197
MIRT006076	hsa-miR-492	MicroarrayqRT-PCR	21319197
MIRT017979	hsa-miR-335-5p	Microarray	18185580
MIRT030941	hsa-miR-21-5p	Microarray	18591254
MIRT040947	hsa-miR-18a-3p	CLASH	23622248
MIRT448173	hsa-miR-5009-3p	PAR-CLIP	22100165
MIRT448172	hsa-miR-924	PAR-CLIP	22100165
MIRT448171	hsa-miR-526b-5p	PAR-CLIP	22100165
MIRT448170	hsa-miR-937-5p	PAR-CLIP	22100165
MIRT448169	hsa-miR-627-5p	PAR-CLIP	22100165
MIRT448168	hsa-miR-3685	PAR-CLIP	22100165
MIRT448167	hsa-miR-384	PAR-CLIP	22100165
MIRT448165	hsa-miR-8081	PAR-CLIP	22100165
MIRT448173	hsa-miR-5009-3p	PAR-CLIP	22100165
MIRT448172	hsa-miR-924	PAR-CLIP	22100165
MIRT448171	hsa-miR-526b-5p	PAR-CLIP	22100165
MIRT448170	hsa-miR-937-5p	PAR-CLIP	22100165
MIRT448169	hsa-miR-627-5p	PAR-CLIP	22100165
MIRT448168	hsa-miR-3685	PAR-CLIP	22100165
MIRT448167	hsa-miR-384	PAR-CLIP	22100165
MIRT448165	hsa-miR-8081	PAR-CLIP	22100165
MIRT030941	hsa-miR-21-5p	HITS-CLIP	22473208
MIRT439531	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT030941	hsa-miR-21-5p	HITS-CLIP	22473208
MIRT439531	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT448173	hsa-miR-5009-3p	PAR-CLIP	22100165
MIRT448172	hsa-miR-924	PAR-CLIP	22100165
MIRT448171	hsa-miR-526b-5p	PAR-CLIP	22100165
MIRT448170	hsa-miR-937-5p	PAR-CLIP	22100165
MIRT448169	hsa-miR-627-5p	PAR-CLIP	22100165
MIRT448168	hsa-miR-3685	PAR-CLIP	22100165
MIRT448167	hsa-miR-384	PAR-CLIP	22100165
MIRT448165	hsa-miR-8081	PAR-CLIP	22100165
MIRT448173	hsa-miR-5009-3p	PAR-CLIP	22100165
MIRT448172	hsa-miR-924	PAR-CLIP	22100165
MIRT448171	hsa-miR-526b-5p	PAR-CLIP	22100165
MIRT448170	hsa-miR-937-5p	PAR-CLIP	22100165
MIRT448169	hsa-miR-627-5p	PAR-CLIP	22100165
MIRT448168	hsa-miR-3685	PAR-CLIP	22100165
MIRT448167	hsa-miR-384	PAR-CLIP	22100165
MIRT448165	hsa-miR-8081	PAR-CLIP	22100165
MIRT1393652	hsa-miR-1252	CLIP-seq
MIRT1393653	hsa-miR-140-3p	CLIP-seq
MIRT1393654	hsa-miR-148a	CLIP-seq
MIRT1393655	hsa-miR-148b	CLIP-seq
MIRT1393656	hsa-miR-152	CLIP-seq
MIRT1393657	hsa-miR-1825	CLIP-seq
MIRT1393658	hsa-miR-21	CLIP-seq
MIRT1393659	hsa-miR-2355-5p	CLIP-seq
MIRT1393660	hsa-miR-3155	CLIP-seq
MIRT1393661	hsa-miR-3155b	CLIP-seq
MIRT1393662	hsa-miR-3173-3p	CLIP-seq
MIRT1393663	hsa-miR-338-3p	CLIP-seq
MIRT1393664	hsa-miR-3616-5p	CLIP-seq
MIRT1393665	hsa-miR-3647-5p	CLIP-seq
MIRT1393666	hsa-miR-3714	CLIP-seq
MIRT1393667	hsa-miR-3908	CLIP-seq
MIRT1393668	hsa-miR-3942-5p	CLIP-seq
MIRT1393669	hsa-miR-4302	CLIP-seq
MIRT1393670	hsa-miR-4438	CLIP-seq
MIRT1393671	hsa-miR-4476	CLIP-seq
MIRT1393672	hsa-miR-4484	CLIP-seq
MIRT1393673	hsa-miR-4496	CLIP-seq
MIRT1393674	hsa-miR-4509	CLIP-seq
MIRT1393675	hsa-miR-4533	CLIP-seq
MIRT1393676	hsa-miR-4635	CLIP-seq
MIRT1393677	hsa-miR-4703-5p	CLIP-seq
MIRT1393678	hsa-miR-4762-5p	CLIP-seq
MIRT1393679	hsa-miR-4766-3p	CLIP-seq
MIRT1393680	hsa-miR-4803	CLIP-seq
MIRT1393681	hsa-miR-484	CLIP-seq
MIRT1393682	hsa-miR-515-5p	CLIP-seq
MIRT1393683	hsa-miR-548an	CLIP-seq
MIRT1393684	hsa-miR-573	CLIP-seq
MIRT1393685	hsa-miR-590-5p	CLIP-seq
MIRT1393686	hsa-miR-592	CLIP-seq
MIRT1393687	hsa-miR-597	CLIP-seq
MIRT1393688	hsa-miR-605	CLIP-seq
MIRT1393689	hsa-miR-634	CLIP-seq
MIRT1393690	hsa-miR-940	CLIP-seq
MIRT1557147	hsa-miR-3620	CLIP-seq
MIRT2340126	hsa-miR-1284	CLIP-seq
MIRT2340127	hsa-miR-2278	CLIP-seq
MIRT2340128	hsa-miR-2355-3p	CLIP-seq
MIRT2340129	hsa-miR-3120-3p	CLIP-seq
MIRT2340130	hsa-miR-337-3p	CLIP-seq
MIRT2340131	hsa-miR-3936	CLIP-seq
MIRT1393668	hsa-miR-3942-5p	CLIP-seq
MIRT2340132	hsa-miR-3976	CLIP-seq
MIRT2340133	hsa-miR-4503	CLIP-seq
MIRT2340134	hsa-miR-4690-3p	CLIP-seq
MIRT1393677	hsa-miR-4703-5p	CLIP-seq
MIRT2340135	hsa-miR-4765	CLIP-seq
MIRT2340136	hsa-miR-4771	CLIP-seq
MIRT2340137	hsa-miR-498	CLIP-seq
MIRT2340138	hsa-miR-499a-5p	CLIP-seq
MIRT2340139	hsa-miR-580	CLIP-seq
MIRT2340140	hsa-miR-662	CLIP-seq
MIRT2340141	hsa-miR-676	CLIP-seq
MIRT2340142	hsa-miR-758	CLIP-seq
MIRT2340143	hsa-miR-759	CLIP-seq
MIRT2395245	hsa-miR-1271	CLIP-seq
MIRT2395246	hsa-miR-182	CLIP-seq
MIRT2395247	hsa-miR-185	CLIP-seq
MIRT2395248	hsa-miR-342-5p	CLIP-seq
MIRT2395249	hsa-miR-3926	CLIP-seq
MIRT2395250	hsa-miR-4306	CLIP-seq
MIRT2395251	hsa-miR-4644	CLIP-seq
MIRT2395252	hsa-miR-4651	CLIP-seq
MIRT2395253	hsa-miR-4664-5p	CLIP-seq
MIRT2395254	hsa-miR-4729	CLIP-seq
MIRT2395255	hsa-miR-4786-5p	CLIP-seq
MIRT2395256	hsa-miR-548s	CLIP-seq
MIRT2395257	hsa-miR-579	CLIP-seq
MIRT2395258	hsa-miR-608	CLIP-seq
MIRT2395259	hsa-miR-664	CLIP-seq
MIRT2395260	hsa-miR-885-3p	CLIP-seq
MIRT2395261	hsa-miR-96	CLIP-seq
MIRT2460612	hsa-miR-3199	CLIP-seq
MIRT2460613	hsa-miR-4515	CLIP-seq
MIRT2460614	hsa-miR-4774-5p	CLIP-seq
MIRT1393652	hsa-miR-1252	CLIP-seq
MIRT2634053	hsa-miR-1915	CLIP-seq
MIRT2634054	hsa-miR-2116	CLIP-seq
MIRT2395248	hsa-miR-342-5p	CLIP-seq
MIRT1393666	hsa-miR-3714	CLIP-seq
MIRT1393671	hsa-miR-4476	CLIP-seq
MIRT1393672	hsa-miR-4484	CLIP-seq
MIRT1393673	hsa-miR-4496	CLIP-seq
MIRT2634055	hsa-miR-4505	CLIP-seq
MIRT1393674	hsa-miR-4509	CLIP-seq
MIRT1393675	hsa-miR-4533	CLIP-seq
MIRT2395252	hsa-miR-4651	CLIP-seq
MIRT2395253	hsa-miR-4664-5p	CLIP-seq
MIRT2634056	hsa-miR-4677-5p	CLIP-seq
MIRT2634057	hsa-miR-4726-3p	CLIP-seq
MIRT2634058	hsa-miR-4731-5p	CLIP-seq
MIRT1393683	hsa-miR-548an	CLIP-seq
MIRT2395258	hsa-miR-608	CLIP-seq
MIRT1393690	hsa-miR-940	CLIP-seq
MIRT1393652	hsa-miR-1252	CLIP-seq
MIRT2634053	hsa-miR-1915	CLIP-seq
MIRT2634054	hsa-miR-2116	CLIP-seq
MIRT2395248	hsa-miR-342-5p	CLIP-seq
MIRT1393666	hsa-miR-3714	CLIP-seq
MIRT1393671	hsa-miR-4476	CLIP-seq
MIRT1393672	hsa-miR-4484	CLIP-seq
MIRT1393673	hsa-miR-4496	CLIP-seq
MIRT2634055	hsa-miR-4505	CLIP-seq
MIRT1393674	hsa-miR-4509	CLIP-seq
MIRT1393675	hsa-miR-4533	CLIP-seq
MIRT2395252	hsa-miR-4651	CLIP-seq
MIRT2395253	hsa-miR-4664-5p	CLIP-seq
MIRT2634056	hsa-miR-4677-5p	CLIP-seq
MIRT2634057	hsa-miR-4726-3p	CLIP-seq
MIRT2634058	hsa-miR-4731-5p	CLIP-seq
MIRT1393683	hsa-miR-548an	CLIP-seq
MIRT2395258	hsa-miR-608	CLIP-seq
MIRT1393689	hsa-miR-634	CLIP-seq
MIRT1393690	hsa-miR-940	CLIP-seq

Show/Hide all (2)

Transcription factor	Regulation	Reference
POU2F1	Unknown	10814704
SP1	Unknown	10814704

Show/Hide all (28)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IDA	20378551
GO:0000139	Component	Golgi membrane	TAS
GO:0003835	Function	Beta-galactoside alpha-2,6-sialyltransferase activity	IBA
GO:0003835	Function	Beta-galactoside alpha-2,6-sialyltransferase activity	IDA	23999306
GO:0003835	Function	Beta-galactoside alpha-2,6-sialyltransferase activity	IEA
GO:0003835	Function	Beta-galactoside alpha-2,6-sialyltransferase activity	TAS
GO:0005515	Function	Protein binding	IPI	16237761
GO:0005576	Component	Extracellular region	IEA
GO:0005794	Component	Golgi apparatus	IBA
GO:0005794	Component	Golgi apparatus	IEA
GO:0006054	Process	N-acetylneuraminate metabolic process	IDA	23999306
GO:0006486	Process	Protein glycosylation	IEA
GO:0006486	Process	Protein glycosylation	IEA
GO:0008373	Function	Sialyltransferase activity	IDA	21081508
GO:0008373	Function	Sialyltransferase activity	IEA
GO:0008373	Function	Sialyltransferase activity	TAS
GO:0016020	Component	Membrane	IEA
GO:0016266	Process	Protein O-linked glycosylation via N-acetyl-galactosamine	TAS
GO:0016740	Function	Transferase activity	IEA
GO:0016757	Function	Glycosyltransferase activity	IEA
GO:0018279	Process	Protein N-linked glycosylation via asparagine	IBA
GO:0018279	Process	Protein N-linked glycosylation via asparagine	IDA	23999306
GO:0018279	Process	Protein N-linked glycosylation via asparagine	IEA
GO:0019082	Process	Viral protein processing	TAS
GO:0032580	Component	Golgi cisterna membrane	IEA
GO:0042803	Function	Protein homodimerization activity	IDA	20378551
GO:0097503	Process	Sialylation	IBA
GO:0097503	Process	Sialylation	IDA	23999306

MIM	HGNC	e!Ensembl
109675	10860	ENSG00000073849

P15907

Protein name

Beta-galactoside alpha-2,6-sialyltransferase 1 (Alpha 2,6-ST 1) (EC 2.4.3.1) (CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,6-sialyltransferase 1) (ST6Gal I) (ST6GalI) (Sialyltransferase 1)

Protein function

Transfers sialic acid from CMP-sialic acid to galactose-containing acceptor substrates. In B lymphocytes, generates neuraminidase-sensitive lymphocyte cell-surface differentiation antigens, such as CDw75, HB-6 and CD76 (PubMed:1730763). {ECO:000

PDB

4JS1 , 4JS2 , 6QVS , 6QVT

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00777	Glyco_transf_29	157 → 386	Glycosyltransferase family 29 (sialyltransferase)	Family

Sequence

MIHTNLKKKFSCCVLVFLLFAVICVWKEKKKGSYYDSFKLQTKEFQVLKSLGKLAMGSDS
QSVSSSSTQDPHRGRQTLGSLRGLAKAKPEASFQVWNKDSSSKNLIPRLQKIWKNYLSMN
KYKVSYKGPGPGIKFSAEALRCHLRDHVNVSMVEVTDFPFNTSEWEGYLPKESIRTKAGP
WGRCAVVSSAGSLKSSQLGREIDDHDAVLRFNGAPTANFQQDVGTKTTIRLMNSQLVTTE
KRFLKDSLYNEGILIVWDPSVYHSDIPKWYQNPDYNFFNNYKTYRKLHPNQPFYILKPQM
PWELWDILQEISPEEIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYYQKFF
DSACTMGAYHPLLYEKNLVKHLNQGTDEDIYLLGKATLPGFRTIHC

Sequence length

406

Interactions

View interactions

	KEGG		Reactome
	N-Glycan biosynthesis Other types of O-glycan biosynthesis Metabolic pathways		Sialic acid metabolism N-Glycan antennae elongation Termination of O-glycan biosynthesis

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (11)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS, ALLERGIC CONTACT	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, TYPE 2	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EOSINOPHILIC ESOPHAGITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IGA GLOMERULONEPHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (124)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	LHGDN	12878221		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	31610800		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	18703050		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Hepatocellular Carcinoma	Liver carcinoma	BEFREE	29981167		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	14507929	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	GWASCAT_DG	28560309		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	28032597, 29191829		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	29654763		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	30730306		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	30730306	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	33836687	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	29654763		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	25465919		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	27588482, 29981167		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	12841680, 25344606, 35676533	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	27588482	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	23358684, 25465919	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	23358684	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	25344606		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	23549466	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	12429811, 24255131, 27340870, 34559939	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	27588482	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	25465919		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	29981167, 31794515		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	29191829, 39260693	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	25556450	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	23549466	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	30016515		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	11585423, 12079299, 24606438, 27986075		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	11585423, 12079299, 24606438, 27986075		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Hepatocellular Carcinoma	Liver carcinoma	BEFREE	29981167		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	14514712		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	11406350, 11722575, 16192407, 21550977, 22266356, 29981167		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	12515997	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	23358684	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	16319516, 20003255, 28377225, 29423671, 30187356, 31308754, 31317190, 31694696		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	10673297, 20003255, 22449099, 32945502	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	11406350	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	16319516		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	22216278		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	22216278	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Allergic Contact	Dermatitis	CTD_human_DG	16033404		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes	Diabetes	BEFREE	28603863		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	28603863		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	36907892	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	21874001	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	26395551, 35467766	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	CTD_human_DG	21874001		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASDB_DG	21874001, 23300278		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASCAT_DG	21874001, 30054458, 30595370, 30718926		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Neoplasms	Esophagus Neoplasm	GWASCAT_DG	22960999		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	GWASDB_DG	22960999		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	35704638	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	27510958		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	27510958		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	20616019, 27510958		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	26028593, 30042224	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	32677771	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	16053379		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	35945262	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	29475939, 37364046	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	LHGDN	19170967		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	26028593		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IGA Glomerulonephritis	Glomerulonephritis	GWASCAT_DG	26028593		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	11559557		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	GWASCAT_DG	28560309		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	31317621		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	24454800	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	14514712, 21147760, 27588482, 28553930, 29981167, 30972697		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	14514712		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	31509989	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	38003522	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	11559557		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	27588482, 29765252, 29981167		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	29981167		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	29981167, 31794515		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	23241603, 30016515		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	28032597		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	27588482, 29569918		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	12931020, 30226606		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	25465919		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10962440, 12798701, 16192407, 22266356, 27216178, 27986075, 28553930, 29233887, 29402301, 29423671, 31317190, 31408003, 31610800, 31694696, 31784620		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	11585423, 12079299, 24606438, 27986075		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	11406350, 11722575, 16192407, 22266356		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	34943806	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	31724708		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	24324693		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	24324693	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12931020, 16319516, 18703050, 20003255, 21147760, 22266356, 25465919, 26794090, 27216178, 27787577, 27986075, 28154177, 29423671, 29475939, 30016515, 30226606, 30972697 View all (2 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms, Intracranial	Intracranial Neoplasm	BEFREE	11559557		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	29981167		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	26395551		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	26395551, 30021629	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	30021629	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	30016515		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	30016515		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	24855066, 29402301, 31610800, 32016470	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	27588482, 37660914	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	28032597		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	29191829		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	29402301, 33148698, 39260693	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	31096997, 31419997		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	27588482, 29569918		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	27428423	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	27588482	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Proteinuria	Proteinuria	Pubtator	32677771	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	28603863		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	34290711	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	29720252, 30913115, 31300460		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin neoplasm	Pubtator	23549466	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	11585423, 12798701		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma	Carcinoma	LHGDN	12798701		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma	Carcinoma	GWASCAT_DG	22960999		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Steatohepatitis	Fatty Liver	BEFREE	19013288		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	12931020, 30226606		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	20003255, 32763973, 33947960	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Supranuclear Palsy Progressive	Progressive supranuclear palsy	Pubtator	33635380	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	14705225		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid cancer follicular	Follicular thyroid cancer	Pubtator	38003522	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	38003522	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	38003522	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	31705333		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	25465919	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	24606438	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

ST6GAL1 (ST6 beta-galactoside alpha-2,6-sialyltransferase 1)