Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	64798
Gene name	DEP domain containing MTOR interacting protein
Gene symbol	DEPTOR
Synonyms (NCBI Gene)	DEP.6DEPDC6hDEPTOR
Chromosome	8
Chromosome location	8q24.12

253

Show/Hide all (253)

miRTarBase ID	miRNA	Experiments	Reference
MIRT518506	hsa-miR-4803	HITS-CLIP	21572407
MIRT518504	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT518503	hsa-miR-654-3p	HITS-CLIP	21572407
MIRT518502	hsa-miR-4796-5p	HITS-CLIP	21572407
MIRT518501	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT518505	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT518505	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT518504	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT518503	hsa-miR-654-3p	HITS-CLIP	21572407
MIRT518502	hsa-miR-4796-5p	HITS-CLIP	21572407
MIRT518501	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT641359	hsa-miR-365a-3p	HITS-CLIP	23824327
MIRT641358	hsa-miR-365b-3p	HITS-CLIP	23824327
MIRT641357	hsa-miR-624-3p	HITS-CLIP	23824327
MIRT641356	hsa-miR-329-5p	HITS-CLIP	23824327
MIRT659077	hsa-miR-4457	HITS-CLIP	23824327
MIRT641355	hsa-miR-3064-3p	HITS-CLIP	23824327
MIRT641354	hsa-miR-3685	HITS-CLIP	23824327
MIRT641353	hsa-miR-384	HITS-CLIP	23824327
MIRT659076	hsa-miR-4668-3p	HITS-CLIP	23824327
MIRT659075	hsa-miR-3145-5p	HITS-CLIP	23824327
MIRT659074	hsa-miR-8063	HITS-CLIP	23824327
MIRT659073	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT659072	hsa-miR-26a-1-3p	HITS-CLIP	23824327
MIRT659071	hsa-miR-26a-2-3p	HITS-CLIP	23824327
MIRT659070	hsa-miR-519d-5p	HITS-CLIP	23824327
MIRT659069	hsa-miR-146a-3p	HITS-CLIP	23824327
MIRT659068	hsa-miR-301a-5p	HITS-CLIP	23824327
MIRT659067	hsa-miR-301b-5p	HITS-CLIP	23824327
MIRT659066	hsa-miR-3921	HITS-CLIP	23824327
MIRT659065	hsa-miR-4653-5p	HITS-CLIP	23824327
MIRT659064	hsa-miR-6773-3p	HITS-CLIP	23824327
MIRT659063	hsa-miR-215-3p	HITS-CLIP	23824327
MIRT659062	hsa-miR-668-3p	HITS-CLIP	23824327
MIRT659061	hsa-miR-3191-5p	HITS-CLIP	23824327
MIRT641359	hsa-miR-365a-3p	HITS-CLIP	23824327
MIRT641358	hsa-miR-365b-3p	HITS-CLIP	23824327
MIRT641357	hsa-miR-624-3p	HITS-CLIP	23824327
MIRT641356	hsa-miR-329-5p	HITS-CLIP	23824327
MIRT641355	hsa-miR-3064-3p	HITS-CLIP	23824327
MIRT641354	hsa-miR-3685	HITS-CLIP	23824327
MIRT641353	hsa-miR-384	HITS-CLIP	23824327
MIRT518504	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT518503	hsa-miR-654-3p	HITS-CLIP	23824327
MIRT518502	hsa-miR-4796-5p	HITS-CLIP	23824327
MIRT518501	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT518505	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT518506	hsa-miR-4803	PAR-CLIP	21572407
MIRT518505	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT518504	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT518503	hsa-miR-654-3p	PAR-CLIP	21572407
MIRT518502	hsa-miR-4796-5p	PAR-CLIP	21572407
MIRT518501	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT518504	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT518503	hsa-miR-654-3p	PAR-CLIP	21572407
MIRT518502	hsa-miR-4796-5p	PAR-CLIP	21572407
MIRT518501	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT518505	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT518506	hsa-miR-4803	PAR-CLIP	23446348
MIRT518505	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT518504	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT518503	hsa-miR-654-3p	PAR-CLIP	23446348
MIRT518502	hsa-miR-4796-5p	PAR-CLIP	23446348
MIRT518501	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT518506	hsa-miR-4803	HITS-CLIP	21572407
MIRT518504	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT518503	hsa-miR-654-3p	HITS-CLIP	21572407
MIRT518502	hsa-miR-4796-5p	HITS-CLIP	21572407
MIRT518501	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT518505	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT518505	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT518504	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT518503	hsa-miR-654-3p	HITS-CLIP	21572407
MIRT518502	hsa-miR-4796-5p	HITS-CLIP	21572407
MIRT518501	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT641359	hsa-miR-365a-3p	HITS-CLIP	23824327
MIRT641358	hsa-miR-365b-3p	HITS-CLIP	23824327
MIRT641357	hsa-miR-624-3p	HITS-CLIP	23824327
MIRT641356	hsa-miR-329-5p	HITS-CLIP	23824327
MIRT659077	hsa-miR-4457	HITS-CLIP	23824327
MIRT641355	hsa-miR-3064-3p	HITS-CLIP	23824327
MIRT641354	hsa-miR-3685	HITS-CLIP	23824327
MIRT641353	hsa-miR-384	HITS-CLIP	23824327
MIRT659076	hsa-miR-4668-3p	HITS-CLIP	23824327
MIRT659075	hsa-miR-3145-5p	HITS-CLIP	23824327
MIRT659074	hsa-miR-8063	HITS-CLIP	23824327
MIRT659073	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT659072	hsa-miR-26a-1-3p	HITS-CLIP	23824327
MIRT659071	hsa-miR-26a-2-3p	HITS-CLIP	23824327
MIRT659070	hsa-miR-519d-5p	HITS-CLIP	23824327
MIRT659069	hsa-miR-146a-3p	HITS-CLIP	23824327
MIRT659068	hsa-miR-301a-5p	HITS-CLIP	23824327
MIRT659067	hsa-miR-301b-5p	HITS-CLIP	23824327
MIRT659066	hsa-miR-3921	HITS-CLIP	23824327
MIRT659065	hsa-miR-4653-5p	HITS-CLIP	23824327
MIRT659064	hsa-miR-6773-3p	HITS-CLIP	23824327
MIRT659063	hsa-miR-215-3p	HITS-CLIP	23824327
MIRT659062	hsa-miR-668-3p	HITS-CLIP	23824327
MIRT659061	hsa-miR-3191-5p	HITS-CLIP	23824327
MIRT641359	hsa-miR-365a-3p	HITS-CLIP	23824327
MIRT641358	hsa-miR-365b-3p	HITS-CLIP	23824327
MIRT641357	hsa-miR-624-3p	HITS-CLIP	23824327
MIRT641356	hsa-miR-329-5p	HITS-CLIP	23824327
MIRT641355	hsa-miR-3064-3p	HITS-CLIP	23824327
MIRT641354	hsa-miR-3685	HITS-CLIP	23824327
MIRT641353	hsa-miR-384	HITS-CLIP	23824327
MIRT518504	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT518503	hsa-miR-654-3p	HITS-CLIP	23824327
MIRT518502	hsa-miR-4796-5p	HITS-CLIP	23824327
MIRT518501	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT518505	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT518506	hsa-miR-4803	PAR-CLIP	21572407
MIRT518505	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT518504	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT518503	hsa-miR-654-3p	PAR-CLIP	21572407
MIRT518502	hsa-miR-4796-5p	PAR-CLIP	21572407
MIRT518501	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT518504	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT518503	hsa-miR-654-3p	PAR-CLIP	21572407
MIRT518502	hsa-miR-4796-5p	PAR-CLIP	21572407
MIRT518501	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT518505	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT518506	hsa-miR-4803	PAR-CLIP	23446348
MIRT518505	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT518504	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT518503	hsa-miR-654-3p	PAR-CLIP	23446348
MIRT518502	hsa-miR-4796-5p	PAR-CLIP	23446348
MIRT518501	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT933012	hsa-miR-1	CLIP-seq
MIRT933013	hsa-miR-103a	CLIP-seq
MIRT933014	hsa-miR-107	CLIP-seq
MIRT933015	hsa-miR-1253	CLIP-seq
MIRT933016	hsa-miR-1270	CLIP-seq
MIRT933017	hsa-miR-147b	CLIP-seq
MIRT933018	hsa-miR-15a	CLIP-seq
MIRT933019	hsa-miR-15b	CLIP-seq
MIRT933020	hsa-miR-16	CLIP-seq
MIRT933021	hsa-miR-195	CLIP-seq
MIRT933022	hsa-miR-206	CLIP-seq
MIRT933023	hsa-miR-297	CLIP-seq
MIRT933024	hsa-miR-3155	CLIP-seq
MIRT933025	hsa-miR-3155b	CLIP-seq
MIRT933026	hsa-miR-3173-3p	CLIP-seq
MIRT933027	hsa-miR-3185	CLIP-seq
MIRT933028	hsa-miR-3612	CLIP-seq
MIRT933029	hsa-miR-3673	CLIP-seq
MIRT933030	hsa-miR-424	CLIP-seq
MIRT933031	hsa-miR-4428	CLIP-seq
MIRT933032	hsa-miR-4432	CLIP-seq
MIRT933033	hsa-miR-4434	CLIP-seq
MIRT933034	hsa-miR-4516	CLIP-seq
MIRT933035	hsa-miR-4521	CLIP-seq
MIRT933036	hsa-miR-4531	CLIP-seq
MIRT933037	hsa-miR-455-5p	CLIP-seq
MIRT933038	hsa-miR-4695-5p	CLIP-seq
MIRT933039	hsa-miR-4704-5p	CLIP-seq
MIRT933040	hsa-miR-4731-3p	CLIP-seq
MIRT933041	hsa-miR-4735-5p	CLIP-seq
MIRT933042	hsa-miR-4775	CLIP-seq
MIRT933043	hsa-miR-4801	CLIP-seq
MIRT933044	hsa-miR-484	CLIP-seq
MIRT933045	hsa-miR-497	CLIP-seq
MIRT933046	hsa-miR-548aa	CLIP-seq
MIRT933047	hsa-miR-548c-3p	CLIP-seq
MIRT933048	hsa-miR-548k	CLIP-seq
MIRT933049	hsa-miR-567	CLIP-seq
MIRT933050	hsa-miR-590-3p	CLIP-seq
MIRT933051	hsa-miR-613	CLIP-seq
MIRT933052	hsa-miR-620	CLIP-seq
MIRT933053	hsa-miR-628-3p	CLIP-seq
MIRT933054	hsa-miR-650	CLIP-seq
MIRT933055	hsa-miR-658	CLIP-seq
MIRT933056	hsa-miR-885-5p	CLIP-seq
MIRT1547950	hsa-miR-1587	CLIP-seq
MIRT1547951	hsa-miR-3123	CLIP-seq
MIRT1547952	hsa-miR-3154	CLIP-seq
MIRT1547953	hsa-miR-3163	CLIP-seq
MIRT1547954	hsa-miR-3925-5p	CLIP-seq
MIRT1547955	hsa-miR-4674	CLIP-seq
MIRT1976228	hsa-miR-181a	CLIP-seq
MIRT1976229	hsa-miR-181b	CLIP-seq
MIRT1976230	hsa-miR-181c	CLIP-seq
MIRT1976231	hsa-miR-181d	CLIP-seq
MIRT1976232	hsa-miR-3143	CLIP-seq
MIRT1976233	hsa-miR-3159	CLIP-seq
MIRT1547953	hsa-miR-3163	CLIP-seq
MIRT1976234	hsa-miR-421	CLIP-seq
MIRT1976235	hsa-miR-4262	CLIP-seq
MIRT1976236	hsa-miR-4272	CLIP-seq
MIRT1976237	hsa-miR-4276	CLIP-seq
MIRT1976238	hsa-miR-4302	CLIP-seq
MIRT1976239	hsa-miR-543	CLIP-seq
MIRT933015	hsa-miR-1253	CLIP-seq
MIRT2211660	hsa-miR-1297	CLIP-seq
MIRT2211661	hsa-miR-1303	CLIP-seq
MIRT933017	hsa-miR-147b	CLIP-seq
MIRT1976228	hsa-miR-181a	CLIP-seq
MIRT1976229	hsa-miR-181b	CLIP-seq
MIRT1976230	hsa-miR-181c	CLIP-seq
MIRT1976231	hsa-miR-181d	CLIP-seq
MIRT2211662	hsa-miR-26a	CLIP-seq
MIRT2211663	hsa-miR-26b	CLIP-seq
MIRT933023	hsa-miR-297	CLIP-seq
MIRT933024	hsa-miR-3155	CLIP-seq
MIRT933025	hsa-miR-3155b	CLIP-seq
MIRT1547953	hsa-miR-3163	CLIP-seq
MIRT933026	hsa-miR-3173-3p	CLIP-seq
MIRT933028	hsa-miR-3612	CLIP-seq
MIRT2211664	hsa-miR-3692	CLIP-seq
MIRT2211665	hsa-miR-3714	CLIP-seq
MIRT1976235	hsa-miR-4262	CLIP-seq
MIRT1976237	hsa-miR-4276	CLIP-seq
MIRT1976238	hsa-miR-4302	CLIP-seq
MIRT933031	hsa-miR-4428	CLIP-seq
MIRT933032	hsa-miR-4432	CLIP-seq
MIRT933033	hsa-miR-4434	CLIP-seq
MIRT2211666	hsa-miR-4465	CLIP-seq
MIRT933034	hsa-miR-4516	CLIP-seq
MIRT933035	hsa-miR-4521	CLIP-seq
MIRT933037	hsa-miR-455-5p	CLIP-seq
MIRT933038	hsa-miR-4695-5p	CLIP-seq
MIRT2211667	hsa-miR-4698	CLIP-seq
MIRT933040	hsa-miR-4731-3p	CLIP-seq
MIRT933043	hsa-miR-4801	CLIP-seq
MIRT933044	hsa-miR-484	CLIP-seq
MIRT2211668	hsa-miR-548a-3p	CLIP-seq
MIRT2211669	hsa-miR-548e	CLIP-seq
MIRT2211670	hsa-miR-548f	CLIP-seq
MIRT933049	hsa-miR-567	CLIP-seq
MIRT2211671	hsa-miR-568	CLIP-seq
MIRT933054	hsa-miR-650	CLIP-seq
MIRT933055	hsa-miR-658	CLIP-seq
MIRT2211672	hsa-miR-671-3p	CLIP-seq
MIRT2211673	hsa-miR-941	CLIP-seq
MIRT933033	hsa-miR-4434	CLIP-seq
MIRT933034	hsa-miR-4516	CLIP-seq
MIRT2679194	hsa-miR-135a	CLIP-seq
MIRT2679195	hsa-miR-135b	CLIP-seq
MIRT2679196	hsa-miR-3117-5p	CLIP-seq
MIRT2679197	hsa-miR-3119	CLIP-seq
MIRT2679198	hsa-miR-3146	CLIP-seq
MIRT2679199	hsa-miR-3606	CLIP-seq
MIRT2679200	hsa-miR-3647-3p	CLIP-seq
MIRT2679201	hsa-miR-3653	CLIP-seq
MIRT2679202	hsa-miR-3658	CLIP-seq
MIRT2211665	hsa-miR-3714	CLIP-seq
MIRT2679203	hsa-miR-4484	CLIP-seq
MIRT2679204	hsa-miR-4503	CLIP-seq
MIRT2679205	hsa-miR-4509	CLIP-seq
MIRT2679206	hsa-miR-4640-3p	CLIP-seq
MIRT2679207	hsa-miR-4780	CLIP-seq
MIRT2679208	hsa-miR-548an	CLIP-seq
MIRT2679209	hsa-miR-940	CLIP-seq

Show/Hide all (31)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000045	Process	Autophagosome assembly	IDA	28890335
GO:0004860	Function	Protein kinase inhibitor activity	IDA	22017875, 22017876, 22017877, 25936805, 34519268, 34519269
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	IBA
GO:0005096	Function	GTPase activator activity	IBA
GO:0005515	Function	Protein binding	IPI	19446321, 25416956, 30080879, 30232230, 32296183
GO:0005764	Component	Lysosome	IEA
GO:0005765	Component	Lysosomal membrane	IDA	25936805
GO:0005765	Component	Lysosomal membrane	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0006469	Process	Negative regulation of protein kinase activity	IMP	19446321
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA
GO:0008289	Function	Lipid binding	IEA
GO:0010507	Process	Negative regulation of autophagy	IDA	32561715
GO:0010508	Process	Positive regulation of autophagy	IDA	22017875, 22017876, 22017877
GO:0016020	Component	Membrane	IEA
GO:0030291	Function	Protein serine/threonine kinase inhibitor activity	IBA
GO:0030291	Function	Protein serine/threonine kinase inhibitor activity	IDA	22017875, 22017876
GO:0031669	Process	Cellular response to nutrient levels	IDA	32561715
GO:0032007	Process	Negative regulation of TOR signaling	IEA
GO:0032007	Process	Negative regulation of TOR signaling	IMP	19446321
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0038202	Process	TORC1 signaling	IDA	12087098
GO:0045792	Process	Negative regulation of cell size	IMP	19446321
GO:0070300	Function	Phosphatidic acid binding	IDA	25936805, 33865870
GO:1903940	Process	Negative regulation of TORC2 signaling	IBA
GO:1903940	Process	Negative regulation of TORC2 signaling	IDA	25936805, 33865870, 34519268, 34634301
GO:1903940	Process	Negative regulation of TORC2 signaling	IGI	33110214
GO:1904262	Process	Negative regulation of TORC1 signaling	IBA
GO:1904262	Process	Negative regulation of TORC1 signaling	IDA	22017875, 22017876, 22017877, 25936805, 33865870, 34519268, 34519269, 34634301
GO:1904262	Process	Negative regulation of TORC1 signaling	IGI	33110214
GO:2001236	Process	Regulation of extrinsic apoptotic signaling pathway	IMP	19446321

MIM	HGNC	e!Ensembl
612974	22953	ENSG00000155792

Q8TB45

Protein name

DEP domain-containing mTOR-interacting protein (hDEPTOR) (DEP domain-containing protein 6)

Protein function

Negative regulator of the mTORC1 and mTORC2 complexes: inhibits the protein kinase activity of MTOR, thereby inactivating both complexes (PubMed:19446321, PubMed:22017875, PubMed:22017876, PubMed:22017877, PubMed:25936805, PubMed:29382726, PubMe

PDB

7DKL , 7OWG , 7PE7 , 7PE8 , 7PE9 , 7PEA , 7PEB , 7PEC , 7PED

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00610	DEP	48 → 117	Domain found in Dishevelled, Egl-10, and Pleckstrin (DEP)	Domain
PF00610	DEP	148 → 217	Domain found in Dishevelled, Egl-10, and Pleckstrin (DEP)	Domain

Sequence

MEEGGSTGSAGSDSSTSGSGGAQQRELERMAEVLVTGEQLRLRLHEEKVIKDRRHHLKTY
PNCFVAKELIDWLIEHKEASDRETAIKLMQKLADRGIIHHVCDEHKEFKDVKLFYRFRKD
DGTFPLDNEVKAFMRGQRLYEKLMSPENTLLQPREEEGVKYERTFMASEFLDWLVQEGEA
TTRKEAEQLCHRLMEHGIIQHVSNKHPFVDSNLLYQFRMNFRRRRRLMELLNEKSPSSQE
THDSPFCLRKQSHDNRKSTSFMSVSPSKEIKIVSAVRRSSMSSCGSSGYFSSSPTLSSSP
PVLCNPKSVLKRPVTSEELLTPGAPYARKTFTIVGDAVGWGFVVRGSKPCHIQAVDPSGP
AAAAGMKVCQFVVSVNGLNVLHVDYRTVSNLILTGPRTIVMEVMEELEC

Sequence length

409

Interactions

View interactions

	KEGG
	Autophagy - animal mTOR signaling pathway

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IDIOPATHIC PULMONARY FIBROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTERSTITIAL LUNG DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (70)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	26896556		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	BEFREE	29457836		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	25119265	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Alzheimer disease type 1	Alzheimer disease	Pubtator	25119265	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	28420429		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	29940800		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	25544749		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	28349073, 29940800		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	28349073, 29940800	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	GWASCAT_DG	26297903		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	33995662	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	39945739	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	26992219	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	28358054	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	34634301	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	25544749	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	37328520	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	26992219	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Endometrioid	Endometrioid cancer	BEFREE	28358054		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	30387804		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	30692212		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	24969890, 27144580, 28000901, 29666061		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	24969890, 35923131	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	37140276	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Differentiated Thyroid Gland Carcinoma	Thyroid Carcinoma	BEFREE	21643629		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	28358054		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	28358054	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	29457836		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	27593934		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	31710517		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	31710517, 36413936	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Jansen type metaphyseal chondrodysplasia	Metaphyseal chondrodysplasia	Pubtator	30232230	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	29670094		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	27593934		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	31228948		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	GWASCAT_DG	23583980		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	GWASDB_DG	23583980		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	25810016		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	28358054		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	30387804		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	25544749		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	31685947		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	22745583, 26742010, 29666061		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	30692212	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	19446321, 23613505, 28420429, 33416146, 35216969	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	27593934, 28420429, 28916338, 29472861, 31395691		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	24969890, 25544749, 25810016, 26896556, 28916338, 29666061, 30387804, 31228948, 31395691, 31685947		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	29973283		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	29973283		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	28932123		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	35295989	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	30387804		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	27211906	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	30387804	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	25544749		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	25544749		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	25544749	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	25544749	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	37140276	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	27593934		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	31685947		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	26558456	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	29799805	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	30692212	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	31710517		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	29940800	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	28267437		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	29457836		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	37469018	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	25810016		★★★★★ ★☆☆☆☆ Found in Text Mining only

DEPTOR (DEP domain containing MTOR interacting protein)