Gene Gene information from NCBI Gene database.
Entrez ID 64785
Gene name GINS complex subunit 3
Gene symbol GINS3
Synonyms (NCBI Gene)
PSF3
Chromosome 16
Chromosome location 16q21
Summary This gene encodes a protein subunit of the GINS heterotetrameric complex, which is essential for the initiation of DNA replication and replisome progression in eukaryotes. Alternatively spliced transcript variants encoding distinct isoforms have been desc
miRNA miRNA information provided by mirtarbase database.
24
miRTarBase ID miRNA Experiments Reference
MIRT016571 hsa-miR-193b-3p Microarray 20304954
MIRT1019211 hsa-miR-1827 CLIP-seq
MIRT1019212 hsa-miR-204 CLIP-seq
MIRT1019213 hsa-miR-211 CLIP-seq
MIRT1019214 hsa-miR-346 CLIP-seq
Transcription factors Transcription factors information provided by TRRUST V2 database.
1
Transcription factor Regulation Reference
E2F1 Unknown 17127213
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
17
GO ID Ontology Definition Evidence Reference
GO:0000811 Component GINS complex IBA
GO:0000811 Component GINS complex IPI 17417653
GO:0005515 Function Protein binding IPI 19805216, 26871637, 32296183, 32814053, 33961781
GO:0005634 Component Nucleus IDA 22474384
GO:0005634 Component Nucleus IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
610610 25851 ENSG00000181938
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9BRX5
Protein name DNA replication complex GINS protein PSF3 (GINS complex subunit 3)
Protein function Required for correct functioning of the GINS complex, a complex that plays an essential role in the initiation of DNA replication, and progression of DNA replication forks (PubMed:17417653, PubMed:28414293). GINS complex is a core component of C
PDB 2E9X , 2EHO , 2Q9Q , 6XTX , 6XTY , 7PFO , 7PLO , 8B9D , 8OK2
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF05916 Sld5 66 173 GINS complex protein Family
Sequence
MSEAYFRVESGALGPEENFLSLDDILMSHEKLPVRTETAMPRLGAFFLERSAGAETDNAV
PQGSKLELPLWLAKGLFDNKRRILSVELPKIYQEGWRTVFSADPNVVDLHKMGPHFYGFG
SQLLHFDSPENADISQSLLQTFIGRFRRIMDSSQNAYNEDTSALVARLDEMER
GLFQTGQ
KGLNDFQCWEKGQASQITASNLVQNYKKRKFTDMED
Sequence length 216
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Unwinding of DNA
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
4
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
DERMATOMYOSITIS GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
EAR, PATELLA, SHORT STATURE SYNDROME Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
GINS3-related disorder Likely benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
MEIER-GORLIN SYNDROME GenCC
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Adenocarcinoma Adenocarcinoma BEFREE 31637868
★☆☆☆☆
Found in Text Mining only
Carcinoma Carcinoma BEFREE 29936059
★☆☆☆☆
Found in Text Mining only
Carcinoma, Endometrioid Endometrioid cancer BEFREE 29936059
★☆☆☆☆
Found in Text Mining only
Colon Carcinoma Colon Carcinoma BEFREE 20059967
★☆☆☆☆
Found in Text Mining only
Colorectal Carcinoma Colorectal Cancer BEFREE 25403684
★☆☆☆☆
Found in Text Mining only
Endometrial Carcinoma Endometrial carcinoma BEFREE 29936059
★☆☆☆☆
Found in Text Mining only
Glioblastoma Glioblastoma BEFREE 30465075
★☆☆☆☆
Found in Text Mining only
Glioblastoma Multiforme Glioblastoma BEFREE 30465075
★☆☆☆☆
Found in Text Mining only
Lung Neoplasms Lung neoplasms Pubtator 23977152 Associate
★☆☆☆☆
Found in Text Mining only
Malignant Neoplasms Malignant Neoplasm BEFREE 20059967, 29936059
★☆☆☆☆
Found in Text Mining only