Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	6477
Gene name	Siah E3 ubiquitin protein ligase 1
Gene symbol	SIAH1
Synonyms (NCBI Gene)	BURHASSIAH1A
Chromosome	16
Chromosome location	16q12.1
Summary	This gene encodes a protein that is a member of the seven in absentia homolog (SIAH) family. The protein is an E3 ligase and is involved in ubiquitination and proteasome-mediated degradation of specific proteins. The activity of this ubiquitin ligase has

168

Show/Hide all (168)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005887	hsa-miR-424-5p	ImmunohistochemistryLuciferase reporter assayNorthern blotqRT-PCRWestern blot	21062812
MIRT005887	hsa-miR-424-5p	ImmunohistochemistryLuciferase reporter assayNorthern blotqRT-PCRWestern blot	21062812
MIRT037958	hsa-miR-505-5p	CLASH	23622248
MIRT438184	hsa-miR-135a-5p	Luciferase reporter assay	24503442
MIRT438184	hsa-miR-135a-5p	Luciferase reporter assay	24503442
MIRT438184	hsa-miR-135a-5p	Luciferase reporter assayWestern blotting	33134300
MIRT1348114	hsa-miR-1262	CLIP-seq
MIRT1348115	hsa-miR-141	CLIP-seq
MIRT1348116	hsa-miR-193a-3p	CLIP-seq
MIRT1348117	hsa-miR-193b	CLIP-seq
MIRT1348118	hsa-miR-200a	CLIP-seq
MIRT1348119	hsa-miR-2115	CLIP-seq
MIRT1348120	hsa-miR-3074-5p	CLIP-seq
MIRT1348121	hsa-miR-329	CLIP-seq
MIRT1348122	hsa-miR-3591-5p	CLIP-seq
MIRT1348123	hsa-miR-3613-3p	CLIP-seq
MIRT1348124	hsa-miR-362-3p	CLIP-seq
MIRT1348125	hsa-miR-3662	CLIP-seq
MIRT1348126	hsa-miR-374c	CLIP-seq
MIRT1348127	hsa-miR-4255	CLIP-seq
MIRT1348128	hsa-miR-4435	CLIP-seq
MIRT1348129	hsa-miR-4455	CLIP-seq
MIRT1348130	hsa-miR-452	CLIP-seq
MIRT1348131	hsa-miR-4637	CLIP-seq
MIRT1348132	hsa-miR-4652-3p	CLIP-seq
MIRT1348133	hsa-miR-4670-3p	CLIP-seq
MIRT1348134	hsa-miR-4676-3p	CLIP-seq
MIRT1348135	hsa-miR-4677-3p	CLIP-seq
MIRT1348136	hsa-miR-4679	CLIP-seq
MIRT1348137	hsa-miR-4699-3p	CLIP-seq
MIRT1348138	hsa-miR-4701-3p	CLIP-seq
MIRT1348139	hsa-miR-4738-3p	CLIP-seq
MIRT1348140	hsa-miR-4742-3p	CLIP-seq
MIRT1348141	hsa-miR-486-5p	CLIP-seq
MIRT1348142	hsa-miR-516a-3p	CLIP-seq
MIRT1348143	hsa-miR-522	CLIP-seq
MIRT1348144	hsa-miR-609	CLIP-seq
MIRT1348145	hsa-miR-635	CLIP-seq
MIRT1348146	hsa-miR-655	CLIP-seq
MIRT1348147	hsa-miR-656	CLIP-seq
MIRT1348148	hsa-miR-891b	CLIP-seq
MIRT1348149	hsa-miR-1275	CLIP-seq
MIRT1348150	hsa-miR-1283	CLIP-seq
MIRT1348151	hsa-miR-1305	CLIP-seq
MIRT1348152	hsa-miR-1323	CLIP-seq
MIRT1348153	hsa-miR-15a	CLIP-seq
MIRT1348154	hsa-miR-15b	CLIP-seq
MIRT1348155	hsa-miR-16	CLIP-seq
MIRT1348156	hsa-miR-195	CLIP-seq
MIRT1348157	hsa-miR-3065-5p	CLIP-seq
MIRT1348158	hsa-miR-3148	CLIP-seq
MIRT1348121	hsa-miR-329	CLIP-seq
MIRT1348159	hsa-miR-340	CLIP-seq
MIRT1348124	hsa-miR-362-3p	CLIP-seq
MIRT1348160	hsa-miR-3920	CLIP-seq
MIRT1348161	hsa-miR-3924	CLIP-seq
MIRT1348162	hsa-miR-421	CLIP-seq
MIRT1348163	hsa-miR-424	CLIP-seq
MIRT1348164	hsa-miR-4269	CLIP-seq
MIRT1348165	hsa-miR-4506	CLIP-seq
MIRT1348166	hsa-miR-4525	CLIP-seq
MIRT1348167	hsa-miR-4665-5p	CLIP-seq
MIRT1348168	hsa-miR-4666-3p	CLIP-seq
MIRT1348169	hsa-miR-4668-5p	CLIP-seq
MIRT1348170	hsa-miR-4723-5p	CLIP-seq
MIRT1348171	hsa-miR-495	CLIP-seq
MIRT1348172	hsa-miR-497	CLIP-seq
MIRT1348173	hsa-miR-532-3p	CLIP-seq
MIRT1348174	hsa-miR-548ac	CLIP-seq
MIRT1348175	hsa-miR-548d-3p	CLIP-seq
MIRT1348176	hsa-miR-548o	CLIP-seq
MIRT1348177	hsa-miR-548z	CLIP-seq
MIRT1348178	hsa-miR-603	CLIP-seq
MIRT1348179	hsa-miR-625	CLIP-seq
MIRT1348180	hsa-miR-662	CLIP-seq
MIRT1348130	hsa-miR-452	CLIP-seq
MIRT1348134	hsa-miR-4676-3p	CLIP-seq
MIRT2103155	hsa-miR-4641	CLIP-seq
MIRT2103156	hsa-miR-548c-3p	CLIP-seq
MIRT1348114	hsa-miR-1262	CLIP-seq
MIRT2327429	hsa-miR-135a	CLIP-seq
MIRT2327430	hsa-miR-135b	CLIP-seq
MIRT1348115	hsa-miR-141	CLIP-seq
MIRT1348116	hsa-miR-193a-3p	CLIP-seq
MIRT1348117	hsa-miR-193b	CLIP-seq
MIRT1348118	hsa-miR-200a	CLIP-seq
MIRT1348119	hsa-miR-2115	CLIP-seq
MIRT2327431	hsa-miR-223	CLIP-seq
MIRT1348158	hsa-miR-3148	CLIP-seq
MIRT1348121	hsa-miR-329	CLIP-seq
MIRT1348124	hsa-miR-362-3p	CLIP-seq
MIRT1348126	hsa-miR-374c	CLIP-seq
MIRT1348164	hsa-miR-4269	CLIP-seq
MIRT2327432	hsa-miR-4426	CLIP-seq
MIRT1348128	hsa-miR-4435	CLIP-seq
MIRT1348129	hsa-miR-4455	CLIP-seq
MIRT1348165	hsa-miR-4506	CLIP-seq
MIRT2103155	hsa-miR-4641	CLIP-seq
MIRT2327433	hsa-miR-4647	CLIP-seq
MIRT2327434	hsa-miR-4662b	CLIP-seq
MIRT1348133	hsa-miR-4670-3p	CLIP-seq
MIRT2327435	hsa-miR-4697-3p	CLIP-seq
MIRT1348138	hsa-miR-4701-3p	CLIP-seq
MIRT1348139	hsa-miR-4738-3p	CLIP-seq
MIRT2327436	hsa-miR-4776-3p	CLIP-seq
MIRT1348142	hsa-miR-516a-3p	CLIP-seq
MIRT1348174	hsa-miR-548ac	CLIP-seq
MIRT1348175	hsa-miR-548d-3p	CLIP-seq
MIRT1348177	hsa-miR-548z	CLIP-seq
MIRT1348178	hsa-miR-603	CLIP-seq
MIRT1348144	hsa-miR-609	CLIP-seq
MIRT1348145	hsa-miR-635	CLIP-seq
MIRT1348146	hsa-miR-655	CLIP-seq
MIRT2327437	hsa-miR-935	CLIP-seq
MIRT2459346	hsa-miR-448	CLIP-seq
MIRT2459347	hsa-miR-586	CLIP-seq
MIRT2459346	hsa-miR-448	CLIP-seq
MIRT2459347	hsa-miR-586	CLIP-seq
MIRT2327429	hsa-miR-135a	CLIP-seq
MIRT2327430	hsa-miR-135b	CLIP-seq
MIRT2327431	hsa-miR-223	CLIP-seq
MIRT2622603	hsa-miR-3136-3p	CLIP-seq
MIRT1348158	hsa-miR-3148	CLIP-seq
MIRT1348121	hsa-miR-329	CLIP-seq
MIRT1348124	hsa-miR-362-3p	CLIP-seq
MIRT2622604	hsa-miR-3677-5p	CLIP-seq
MIRT1348164	hsa-miR-4269	CLIP-seq
MIRT2327432	hsa-miR-4426	CLIP-seq
MIRT2622605	hsa-miR-4519	CLIP-seq
MIRT2103155	hsa-miR-4641	CLIP-seq
MIRT2327433	hsa-miR-4647	CLIP-seq
MIRT2327434	hsa-miR-4662b	CLIP-seq
MIRT1348169	hsa-miR-4668-5p	CLIP-seq
MIRT2327435	hsa-miR-4697-3p	CLIP-seq
MIRT2622606	hsa-miR-4719	CLIP-seq
MIRT1348140	hsa-miR-4742-3p	CLIP-seq
MIRT1348171	hsa-miR-495	CLIP-seq
MIRT1348173	hsa-miR-532-3p	CLIP-seq
MIRT1348174	hsa-miR-548ac	CLIP-seq
MIRT1348175	hsa-miR-548d-3p	CLIP-seq
MIRT1348177	hsa-miR-548z	CLIP-seq
MIRT1348178	hsa-miR-603	CLIP-seq
MIRT1348180	hsa-miR-662	CLIP-seq
MIRT2622607	hsa-miR-663b	CLIP-seq
MIRT2327437	hsa-miR-935	CLIP-seq
MIRT2327429	hsa-miR-135a	CLIP-seq
MIRT2327430	hsa-miR-135b	CLIP-seq
MIRT2327431	hsa-miR-223	CLIP-seq
MIRT2622603	hsa-miR-3136-3p	CLIP-seq
MIRT1348158	hsa-miR-3148	CLIP-seq
MIRT1348121	hsa-miR-329	CLIP-seq
MIRT1348124	hsa-miR-362-3p	CLIP-seq
MIRT2622604	hsa-miR-3677-5p	CLIP-seq
MIRT1348164	hsa-miR-4269	CLIP-seq
MIRT2327432	hsa-miR-4426	CLIP-seq
MIRT2622605	hsa-miR-4519	CLIP-seq
MIRT2103155	hsa-miR-4641	CLIP-seq
MIRT2327433	hsa-miR-4647	CLIP-seq
MIRT2327434	hsa-miR-4662b	CLIP-seq
MIRT1348169	hsa-miR-4668-5p	CLIP-seq
MIRT2327435	hsa-miR-4697-3p	CLIP-seq
MIRT2622606	hsa-miR-4719	CLIP-seq
MIRT1348140	hsa-miR-4742-3p	CLIP-seq
MIRT1348174	hsa-miR-548ac	CLIP-seq
MIRT1348175	hsa-miR-548d-3p	CLIP-seq
MIRT1348177	hsa-miR-548z	CLIP-seq
MIRT2622607	hsa-miR-663b	CLIP-seq
MIRT2327437	hsa-miR-935	CLIP-seq

Show/Hide all (2)

Transcription factor	Regulation	Reference
EHMT2	Repression	21847359
TP53	Unknown	20421190

Show/Hide all (51)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004842	Function	Ubiquitin-protein transferase activity	IEA
GO:0004842	Function	Ubiquitin-protein transferase activity	IMP	21185211
GO:0004842	Function	Ubiquitin-protein transferase activity	ISS
GO:0004842	Function	Ubiquitin-protein transferase activity	TAS
GO:0005515	Function	Protein binding	IPI	11389840, 11483518, 16085652, 16230351, 19549727, 21078624, 21185211, 21516116, 21878328, 21988832, 23840749, 25416956, 25910212, 26871637, 28546513, 32296183, 32814053, 33591310
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	9334332
GO:0005769	Component	Early endosome	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IDA	23001567
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IEA
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	ISS
GO:0006915	Process	Apoptotic process	IEA
GO:0006915	Process	Apoptotic process	TAS	9403064
GO:0007283	Process	Spermatogenesis	IEA
GO:0007399	Process	Nervous system development	TAS	9334332
GO:0007411	Process	Axon guidance	TAS	9334332
GO:0008270	Function	Zinc ion binding	IDA	11863358, 16085652
GO:0008270	Function	Zinc ion binding	IEA
GO:0008270	Function	Zinc ion binding	ISS
GO:0009653	Process	Anatomical structure morphogenesis	TAS	9403064
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0030163	Process	Protein catabolic process	IDA	11389840
GO:0030877	Component	Beta-catenin destruction complex	IDA	16085652
GO:0031624	Function	Ubiquitin conjugating enzyme binding	IBA
GO:0031648	Process	Protein destabilization	IEA
GO:0042802	Function	Identical protein binding	IPI	21988832, 22493164, 25416956
GO:0043065	Process	Positive regulation of apoptotic process	IDA	21185211
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IBA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IDA	33591310
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IMP	28546513
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0051402	Process	Neuron apoptotic process	IEA
GO:0051402	Process	Neuron apoptotic process	ISS
GO:0060070	Process	Canonical Wnt signaling pathway	IEA
GO:0060070	Process	Canonical Wnt signaling pathway	IMP	28546513, 32430360
GO:0061630	Function	Ubiquitin protein ligase activity	IBA
GO:0061630	Function	Ubiquitin protein ligase activity	IDA	23001567
GO:0061630	Function	Ubiquitin protein ligase activity	IEA
GO:0061630	Function	Ubiquitin protein ligase activity	IMP	28546513
GO:1990000	Process	Amyloid fibril formation	IEA
GO:1990000	Process	Amyloid fibril formation	TAS
GO:2001233	Process	Regulation of apoptotic signaling pathway	IEA
GO:2001244	Process	Positive regulation of intrinsic apoptotic signaling pathway	IMP	21185211

MIM	HGNC	e!Ensembl
602212	10857	ENSG00000196470

Q8IUQ4

Protein name

E3 ubiquitin-protein ligase SIAH1 (EC 2.3.2.27) (RING-type E3 ubiquitin transferase SIAH1) (Seven in absentia homolog 1) (Siah-1) (Siah-1a)

Protein function

E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of target proteins (PubMed:14506261, PubMed:14645235, PubMed:14654780, PubMed:15064394, PubMed:16085652, PubMed:19224863, PubMed:20508617, PubMed:224

PDB

2A25 , 4C9Z , 4CA1 , 4I7B , 4I7C , 4I7D , 4X3G , 5WZZ , 8HEO , 9G0L

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03145	Sina	82 → 278	Seven in absentia protein family	Family

Tissue specificity

TISSUE SPECIFICITY: Widely expressed at a low level. Down-regulated in advanced hepatocellular carcinomas. {ECO:0000269|PubMed:12557228, ECO:0000269|PubMed:9403064}.

Sequence

MSRQTATALPTGTSKCPPSQRVPALTGTTASNNDLASLFECPVCFDYVLPPILQCQSGHL
VCSNCRPKLTCCPTCRGPLGSIRNLAMEKVANSVLFPCKYASSGCEITLPHTEKADHEEL
CEFRPYSCPCPGASCKWQGSLDAVMPHLMHQHKSITTLQGEDIVFLATDINLPGAVDWVM
MQSCFGFHFMLVLEKQEKYDGHQQFFAIVQLIGTRKQAENFAYRLELNGHRRRLTWEATP
RSIHEGIATAIMNSDCLVFDTSIAQLFAENGNLGINVTISMC

Sequence length

282

Interactions

View interactions

	KEGG		Reactome
	p53 signaling pathway Ubiquitin mediated proteolysis Mitophagy - animal Wnt signaling pathway		Netrin-1 signaling Amyloid fiber formation Antigen processing: Ubiquitination & Proteasome degradation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (2)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Buratti-Harel syndrome	Pathogenic; Likely pathogenic	rs2151043918, rs2151044011, rs2151044152, rs2151043908, rs2151044134, rs2151043928, rs2544514083	RCV001398834 RCV001398836 RCV001398838 RCV001398840 RCV001398841 RCV002249166 RCV004555198 View all (2 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Neurodevelopmental disorder	Likely pathogenic	rs2151044134	RCV001779165	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
COMPLEX NEURODEVELOPMENTAL DISORDER	—	GenCC	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEVELOPMENTAL DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-SPECIFIC SYNDROMIC INTELLECTUAL DISABILITY	—	Disgenet, Orphanet Disgenet, Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (58)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	15190077, 16735606		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	31322210		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	20682032, 25851994, 26654769		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	19775288, 20144232, 20682032, 26654769, 27377268, 31171715	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	21062812	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	32774060	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	21878328	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	35951361	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	36385010	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	26437300		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	24503442		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	10956387		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	30979372		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	32774060	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conn Syndrome	Conn Syndrome	BEFREE	29212953		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	28600779	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	26438826	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	21062812		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	30323224, 30796178		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	30796178	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	35723276	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	30323224, 30796178		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	25572001		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	30796178	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	37686160	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperaldosteronism	Hyperaldosteronism	BEFREE	29212953		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	21466614	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	28600779	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	35960109	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	12557228, 21356256, 21878328, 22323152		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	12557228, 18314624		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	25572001		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	20682032, 25851994, 26654769		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of oropharynx	Malignant Neoplasm Of Oropharynx	BEFREE	20215420		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	26028498		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	15467739, 28481365		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	28784114		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	10956387		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	27377268		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	30771432		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	36534449	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	23228635		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	23228635	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10393949, 10956387, 12557228, 20682032, 21062812, 21356256, 21947242, 23228635, 24503442, 25572001, 25851994, 26654769, 27616748, 27776223		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	29217406		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oropharyngeal Carcinoma	Oropharyngeal Carcinoma	BEFREE	20215420		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oropharyngeal Neoplasms	Oropharyngeal neoplasm	Pubtator	20215420	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	35951361	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	18089810		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	16752048, 18065497, 29217406		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	LHGDN	18065497		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	26722480	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	27616748		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	28843785		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	15467739, 28481365		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	15467739		★★★★★ ★☆☆☆☆ Found in Text Mining only
Telomeric 22q13 Monosomy Syndrome	22q13 monosomy syndrome	Pubtator	35261172	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	25851994		★★★★★ ★☆☆☆☆ Found in Text Mining only

SIAH1 (siah E3 ubiquitin protein ligase 1)