Gene Gene information from NCBI Gene database.
Entrez ID 64764
Gene name CAMP responsive element binding protein 3 like 2
Gene symbol CREB3L2
Synonyms (NCBI Gene)
BBF2H7
Chromosome 7
Chromosome location 7q33
Summary This gene encodes a member of the oasis bZIP transcription factor family. Members of this family can dimerize but form homodimers only. The encoded protein is a transcriptional activator. Translocations between this gene on chromosome 7 and the gene fused
miRNA miRNA information provided by mirtarbase database.
1064
miRTarBase ID miRNA Experiments Reference
MIRT002706 hsa-miR-124-3p Microarray 15685193
MIRT002706 hsa-miR-124-3p Microarray;Other 15685193
MIRT031185 hsa-miR-19b-3p Sequencing 20371350
MIRT051241 hsa-miR-16-5p CLASH 23622248
MIRT049799 hsa-miR-92a-3p CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
31
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000976 Function Transcription cis-regulatory region binding IEA
GO:0000976 Function Transcription cis-regulatory region binding IMP 17178827
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IEA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
608834 23720 ENSG00000182158
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q70SY1
Protein name Cyclic AMP-responsive element-binding protein 3-like protein 2 (cAMP-responsive element-binding protein 3-like protein 2) (BBF2 human homolog on chromosome 7) [Cleaved into: Processed cyclic AMP-responsive element-binding protein 3-like protein 2]
Protein function Transcription factor involved in unfolded protein response (UPR). In the absence of endoplasmic reticulum (ER) stress, inserted into ER membranes, with N-terminal DNA-binding and transcription activation domains oriented toward the cytosolic fac
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00170 bZIP_1 292 355 bZIP transcription factor Coiled-coil
Tissue specificity TISSUE SPECIFICITY: Widely expressed with highest levels in placenta, lung, spleen and intestine, and lowest levels in heart, brain, skeletal muscle, thymus, colon and leukocytes. In fetal tissues, the weakest expression is detected in brain and heart. {E
Sequence
MEVLESGEQGVLQWDRKLSELSEPGDGEALMYHTHFSELLDEFSQNVLGQLLNDPFLSEK
SVSMEVEPSPTSPAPLIQAEHSYSLCEEPRAQSPFTHITTSDSFNDDEVESEKWYLSTDF
PSTSIKTEPVTDEPPPGLVPSVTLTITAISTPLEKEEPPLEMNTGVDSSCQTIIPKIKLE
PHEVDQFLNFSPKEAPVDHLHLPPTPPSSHGSDSEGSLSPNPRLHPFSLPQTHSPSRAAP
RAPSALSSSPLLTAPHKLQGSGPLVLTEEEKRTLIAEGYPIPTKLPLSKSEEKALKKIRR
KIKNKISAQESRRKKKEYMDSLEKKVESCSTENLELRKKVEVLENTNRTLLQQLQ
KLQTL
VMGKVSRTCKLAGTQTGTCLMVVVLCFAVAFGSFFQGYGPYPSATKMALPSQHSLQEPYT
ASVVRSRNLLIYEEHSPPEESSSPGSAGELGGWDRGSSLLRVSGLESRPDVDLPHFIISN
ETSLEKSVLLELQQHLVSAKLEGNETLKVVELDRRVNTTF
Sequence length 520
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG 
  cGMP-PKG signaling pathway
cAMP signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Longevity regulating pathway
Adrenergic signaling in cardiomyocytes
TNF signaling pathway
Thermogenesis
Cholinergic synapse
Dopaminergic synapse
Insulin secretion
Estrogen signaling pathway
Melanogenesis
Thyroid hormone synthesis
Glucagon signaling pathway
Aldosterone synthesis and secretion
Relaxin signaling pathway
Cortisol synthesis and secretion
Parathyroid hormone synthesis, secretion and action
Insulin resistance
Cushing syndrome
Growth hormone synthesis, secretion and action
Vasopressin-regulated water reabsorption
Huntington disease
Prion disease
Cocaine addiction
Amphetamine addiction
Alcoholism
Hepatitis B
Human cytomegalovirus infection
Human papillomavirus infection
Human T-cell leukemia virus 1 infection
Viral carcinogenesis
Chemical carcinogenesis - receptor activation
Prostate cancer
 
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
STROKE GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Alzheimer Disease Alzheimer disease Pubtator 36867706 Associate
★☆☆☆☆
Found in Text Mining only
Carcinogenesis Carcinogenesis Pubtator 34104084 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma Carcinoma BEFREE 18757431
★☆☆☆☆
Found in Text Mining only
Ectodermal Dysplasia Anhidrotic with Immunodeficiency Osteopetrosis and Lymphedema Anhidrotic ectodermal dysplasia with immunodeficiency, osteopetrosis, and lymphedema Pubtator 27023521 Associate
★☆☆☆☆
Found in Text Mining only
Extraskeletal Myxoid Chondrosarcoma Extraskeletal Myxoid Chondrosarcoma BEFREE 18162764
★☆☆☆☆
Found in Text Mining only
Fibromyxosarcoma Fibromyxosarcoma ORPHANET_DG
★☆☆☆☆
Found in Text Mining only
Fibrosarcoma Fibrosarcoma BEFREE 16931951
★☆☆☆☆
Found in Text Mining only
Fibrosarcoma Fibrosarcoma LHGDN 17721195
★☆☆☆☆
Found in Text Mining only
Glioblastoma Glioblastoma BEFREE 25955804
★☆☆☆☆
Found in Text Mining only
Glioblastoma Glioblastoma Pubtator 25955804 Stimulate
★☆☆☆☆
Found in Text Mining only