Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Entrez ID	6474
Gene name	SHOX homeobox 2
Gene symbol	SHOX2
Synonyms (NCBI Gene)	OG12OG12XSHOT
Chromosome	3
Chromosome location	3q25.32
Summary	This gene is a member of the homeobox family of genes that encode proteins containing a 60-amino acid residue motif that represents a DNA binding domain. Homeobox genes have been characterized extensively as transcriptional regulators involved in pattern

221

Show/Hide all (221)

miRTarBase ID	miRNA	Experiments	Reference
MIRT508456	hsa-miR-8076	HITS-CLIP	21572407
MIRT508455	hsa-miR-183-5p	HITS-CLIP	21572407
MIRT508454	hsa-miR-4470	HITS-CLIP	21572407
MIRT508457	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT508456	hsa-miR-8076	HITS-CLIP	21572407
MIRT508455	hsa-miR-183-5p	HITS-CLIP	21572407
MIRT508454	hsa-miR-4470	HITS-CLIP	21572407
MIRT514862	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT508458	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT617612	hsa-miR-148a-5p	HITS-CLIP	23824327
MIRT617611	hsa-miR-5088-3p	HITS-CLIP	23824327
MIRT617610	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT617609	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT617607	hsa-miR-642b-5p	HITS-CLIP	23824327
MIRT617606	hsa-miR-7111-3p	HITS-CLIP	23824327
MIRT617605	hsa-miR-6780a-3p	HITS-CLIP	23824327
MIRT617604	hsa-miR-6881-3p	HITS-CLIP	23824327
MIRT617603	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT617601	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT617600	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT617599	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT617612	hsa-miR-148a-5p	HITS-CLIP	23824327
MIRT617611	hsa-miR-5088-3p	HITS-CLIP	23824327
MIRT617610	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT617609	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT617607	hsa-miR-642b-5p	HITS-CLIP	23824327
MIRT639171	hsa-miR-3653-3p	HITS-CLIP	23824327
MIRT639170	hsa-miR-623	HITS-CLIP	23824327
MIRT639169	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT639168	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT617606	hsa-miR-7111-3p	HITS-CLIP	23824327
MIRT617605	hsa-miR-6780a-3p	HITS-CLIP	23824327
MIRT617604	hsa-miR-6881-3p	HITS-CLIP	23824327
MIRT617603	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT639167	hsa-miR-3658	HITS-CLIP	23824327
MIRT639166	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT639165	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT617601	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT617600	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT617599	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT508458	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT508457	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT508456	hsa-miR-8076	HITS-CLIP	23824327
MIRT508455	hsa-miR-183-5p	HITS-CLIP	23824327
MIRT508454	hsa-miR-4470	HITS-CLIP	23824327
MIRT514862	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT617612	hsa-miR-148a-5p	HITS-CLIP	23824327
MIRT617611	hsa-miR-5088-3p	HITS-CLIP	23824327
MIRT617610	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT617609	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT617608	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT617607	hsa-miR-642b-5p	HITS-CLIP	23824327
MIRT617606	hsa-miR-7111-3p	HITS-CLIP	23824327
MIRT617605	hsa-miR-6780a-3p	HITS-CLIP	23824327
MIRT617604	hsa-miR-6881-3p	HITS-CLIP	23824327
MIRT617603	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT617602	hsa-miR-511-5p	HITS-CLIP	23824327
MIRT617601	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT617600	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT617599	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT508458	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT508457	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT508456	hsa-miR-8076	PAR-CLIP	21572407
MIRT508455	hsa-miR-183-5p	PAR-CLIP	21572407
MIRT508454	hsa-miR-4470	PAR-CLIP	21572407
MIRT508453	hsa-miR-5004-5p	PAR-CLIP	21572407
MIRT508458	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT508457	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT514862	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT508453	hsa-miR-5004-5p	PAR-CLIP	21572407
MIRT526360	hsa-miR-6771-3p	PAR-CLIP	22012620
MIRT508458	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT508457	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT514866	hsa-miR-3074-3p	PAR-CLIP	23446348
MIRT508456	hsa-miR-8076	PAR-CLIP	23446348
MIRT514865	hsa-miR-1246	PAR-CLIP	23446348
MIRT508455	hsa-miR-183-5p	PAR-CLIP	23446348
MIRT514864	hsa-miR-3201	PAR-CLIP	23446348
MIRT514863	hsa-miR-4791	PAR-CLIP	23446348
MIRT508454	hsa-miR-4470	PAR-CLIP	23446348
MIRT514862	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT508453	hsa-miR-5004-5p	PAR-CLIP	23446348
MIRT508458	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT508457	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT508456	hsa-miR-8076	PAR-CLIP	23446348
MIRT508455	hsa-miR-183-5p	PAR-CLIP	23446348
MIRT508454	hsa-miR-4470	PAR-CLIP	23446348
MIRT508453	hsa-miR-5004-5p	PAR-CLIP	23446348
MIRT449210	hsa-miR-3613-3p	PAR-CLIP	22100165
MIRT449209	hsa-miR-5585-3p	PAR-CLIP	22100165
MIRT449208	hsa-miR-4668-5p	PAR-CLIP	22100165
MIRT756037	hsa-miR-24-1-5p	PAR-CLIP	26701625
MIRT508456	hsa-miR-8076	HITS-CLIP	21572407
MIRT508455	hsa-miR-183-5p	HITS-CLIP	21572407
MIRT508454	hsa-miR-4470	HITS-CLIP	21572407
MIRT508457	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT508456	hsa-miR-8076	HITS-CLIP	21572407
MIRT508455	hsa-miR-183-5p	HITS-CLIP	21572407
MIRT508454	hsa-miR-4470	HITS-CLIP	21572407
MIRT514862	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT508458	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT617612	hsa-miR-148a-5p	HITS-CLIP	23824327
MIRT617611	hsa-miR-5088-3p	HITS-CLIP	23824327
MIRT617610	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT617609	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT617607	hsa-miR-642b-5p	HITS-CLIP	23824327
MIRT617606	hsa-miR-7111-3p	HITS-CLIP	23824327
MIRT617605	hsa-miR-6780a-3p	HITS-CLIP	23824327
MIRT617604	hsa-miR-6881-3p	HITS-CLIP	23824327
MIRT617603	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT617601	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT617600	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT617599	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT617612	hsa-miR-148a-5p	HITS-CLIP	23824327
MIRT617611	hsa-miR-5088-3p	HITS-CLIP	23824327
MIRT617610	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT617609	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT617607	hsa-miR-642b-5p	HITS-CLIP	23824327
MIRT639171	hsa-miR-3653-3p	HITS-CLIP	23824327
MIRT639170	hsa-miR-623	HITS-CLIP	23824327
MIRT639169	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT639168	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT617606	hsa-miR-7111-3p	HITS-CLIP	23824327
MIRT617605	hsa-miR-6780a-3p	HITS-CLIP	23824327
MIRT617604	hsa-miR-6881-3p	HITS-CLIP	23824327
MIRT617603	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT639167	hsa-miR-3658	HITS-CLIP	23824327
MIRT639166	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT639165	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT617601	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT617600	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT617599	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT508458	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT508457	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT508456	hsa-miR-8076	HITS-CLIP	23824327
MIRT508455	hsa-miR-183-5p	HITS-CLIP	23824327
MIRT508454	hsa-miR-4470	HITS-CLIP	23824327
MIRT514862	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT617612	hsa-miR-148a-5p	HITS-CLIP	23824327
MIRT617611	hsa-miR-5088-3p	HITS-CLIP	23824327
MIRT617610	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT617609	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT617608	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT617607	hsa-miR-642b-5p	HITS-CLIP	23824327
MIRT617606	hsa-miR-7111-3p	HITS-CLIP	23824327
MIRT617605	hsa-miR-6780a-3p	HITS-CLIP	23824327
MIRT617604	hsa-miR-6881-3p	HITS-CLIP	23824327
MIRT617603	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT617602	hsa-miR-511-5p	HITS-CLIP	23824327
MIRT617601	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT617600	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT617599	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT508458	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT508457	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT508456	hsa-miR-8076	PAR-CLIP	21572407
MIRT508455	hsa-miR-183-5p	PAR-CLIP	21572407
MIRT508454	hsa-miR-4470	PAR-CLIP	21572407
MIRT508453	hsa-miR-5004-5p	PAR-CLIP	21572407
MIRT508458	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT508457	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT514862	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT508453	hsa-miR-5004-5p	PAR-CLIP	21572407
MIRT526360	hsa-miR-6771-3p	PAR-CLIP	22012620
MIRT508458	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT508457	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT514866	hsa-miR-3074-3p	PAR-CLIP	23446348
MIRT508456	hsa-miR-8076	PAR-CLIP	23446348
MIRT514865	hsa-miR-1246	PAR-CLIP	23446348
MIRT508455	hsa-miR-183-5p	PAR-CLIP	23446348
MIRT514864	hsa-miR-3201	PAR-CLIP	23446348
MIRT514863	hsa-miR-4791	PAR-CLIP	23446348
MIRT508454	hsa-miR-4470	PAR-CLIP	23446348
MIRT514862	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT508453	hsa-miR-5004-5p	PAR-CLIP	23446348
MIRT508458	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT508457	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT508456	hsa-miR-8076	PAR-CLIP	23446348
MIRT508455	hsa-miR-183-5p	PAR-CLIP	23446348
MIRT508454	hsa-miR-4470	PAR-CLIP	23446348
MIRT508453	hsa-miR-5004-5p	PAR-CLIP	23446348
MIRT449210	hsa-miR-3613-3p	PAR-CLIP	22100165
MIRT449209	hsa-miR-5585-3p	PAR-CLIP	22100165
MIRT449208	hsa-miR-4668-5p	PAR-CLIP	22100165
MIRT756037	hsa-miR-24-1-5p	Luciferase reporter assayWestern blotting	36917325
MIRT1347543	hsa-miR-3189-3p	CLIP-seq
MIRT1347544	hsa-miR-515-5p	CLIP-seq
MIRT1347545	hsa-miR-659	CLIP-seq
MIRT1347546	hsa-miR-1252	CLIP-seq
MIRT1347547	hsa-miR-2355-5p	CLIP-seq
MIRT1347548	hsa-miR-3679-3p	CLIP-seq
MIRT1347549	hsa-miR-4286	CLIP-seq
MIRT1347550	hsa-miR-4731-3p	CLIP-seq
MIRT1347551	hsa-miR-4801	CLIP-seq
MIRT1347550	hsa-miR-4731-3p	CLIP-seq
MIRT1347551	hsa-miR-4801	CLIP-seq
MIRT2622539	hsa-miR-3671	CLIP-seq
MIRT2622540	hsa-miR-374c	CLIP-seq
MIRT2622541	hsa-miR-4434	CLIP-seq
MIRT2622542	hsa-miR-4516	CLIP-seq
MIRT2622543	hsa-miR-4531	CLIP-seq
MIRT2622544	hsa-miR-4704-5p	CLIP-seq
MIRT2622545	hsa-miR-4775	CLIP-seq
MIRT2622546	hsa-miR-490-5p	CLIP-seq
MIRT2622547	hsa-miR-520d-5p	CLIP-seq
MIRT2622548	hsa-miR-524-5p	CLIP-seq
MIRT2622549	hsa-miR-549	CLIP-seq
MIRT2622550	hsa-miR-590-3p	CLIP-seq
MIRT2622551	hsa-miR-598	CLIP-seq
MIRT2622552	hsa-miR-655	CLIP-seq
MIRT2622539	hsa-miR-3671	CLIP-seq
MIRT2622540	hsa-miR-374c	CLIP-seq
MIRT2622541	hsa-miR-4434	CLIP-seq
MIRT2622542	hsa-miR-4516	CLIP-seq
MIRT2622543	hsa-miR-4531	CLIP-seq
MIRT2622544	hsa-miR-4704-5p	CLIP-seq
MIRT2622545	hsa-miR-4775	CLIP-seq
MIRT2622546	hsa-miR-490-5p	CLIP-seq
MIRT2622549	hsa-miR-549	CLIP-seq
MIRT2622550	hsa-miR-590-3p	CLIP-seq
MIRT2622551	hsa-miR-598	CLIP-seq
MIRT2622552	hsa-miR-655	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
ARX	Unknown	23771350

Show/Hide all (50)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	ISS
GO:0000785	Component	Chromatin	ISA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001501	Process	Skeletal system development	TAS	9482898
GO:0001649	Process	Osteoblast differentiation	IEA
GO:0002027	Process	Regulation of heart rate	IEA
GO:0002027	Process	Regulation of heart rate	ISS
GO:0002053	Process	Positive regulation of mesenchymal cell proliferation	IEA
GO:0002062	Process	Chondrocyte differentiation	IEA
GO:0002063	Process	Chondrocyte development	IEA
GO:0003163	Process	Sinoatrial node development	IEA
GO:0003163	Process	Sinoatrial node development	ISS
GO:0003170	Process	Heart valve development	IEA
GO:0003172	Process	Sinoatrial valve development	IEA
GO:0003172	Process	Sinoatrial valve development	ISS
GO:0003209	Process	Cardiac atrium morphogenesis	IEA
GO:0003213	Process	Cardiac right atrium morphogenesis	IEA
GO:0003213	Process	Cardiac right atrium morphogenesis	ISS
GO:0003677	Function	DNA binding	IEA
GO:0005515	Function	Protein binding	IPI	32814053
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0007224	Process	Smoothened signaling pathway	IEA
GO:0007399	Process	Nervous system development	TAS	9482898
GO:0010463	Process	Mesenchymal cell proliferation	IEA
GO:0030326	Process	Embryonic limb morphogenesis	IEA
GO:0032330	Process	Regulation of chondrocyte differentiation	IEA
GO:0035115	Process	Embryonic forelimb morphogenesis	IEA
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0045880	Process	Positive regulation of smoothened signaling pathway	IEA
GO:0048557	Process	Embryonic digestive tract morphogenesis	IEA
GO:0048598	Process	Embryonic morphogenesis	IEA
GO:0048743	Process	Positive regulation of skeletal muscle fiber development	IEA
GO:0050772	Process	Positive regulation of axonogenesis	IEA
GO:0060272	Process	Embryonic skeletal joint morphogenesis	IEA
GO:0060351	Process	Cartilage development involved in endochondral bone morphogenesis	IEA
GO:0060415	Process	Muscle tissue morphogenesis	IEA
GO:0060920	Process	Cardiac pacemaker cell differentiation	IEA
GO:0060920	Process	Cardiac pacemaker cell differentiation	ISS
GO:0060931	Process	Sinoatrial node cell development	IEA
GO:0060931	Process	Sinoatrial node cell development	ISS
GO:0072089	Process	Stem cell proliferation	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IBA
GO:2000172	Process	Regulation of branching morphogenesis of a nerve	IEA
GO:2000648	Process	Positive regulation of stem cell proliferation	IEA

MIM	HGNC	e!Ensembl
602504	10854	ENSG00000168779

O60902

Protein name

Short stature homeobox protein 2 (Homeobox protein Og12X) (Paired-related homeobox protein SHOT)

Protein function

May be a growth regulator and have a role in specifying neural systems involved in processing somatosensory information, as well as in face and body structure formation.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00046	Homeodomain	141 → 197	Homeodomain	Domain
PF03826	OAR	310 → 327	OAR motif	Motif

Tissue specificity

TISSUE SPECIFICITY: Expressed in heart, skeletal muscle, liver, lung, bone marrow fibroblast, pancreas and placenta.

Sequence

MEELTAFVSKSFDQKVKEKKEAITYREVLESGPLRGAKEPTGCTEAGRDDRSSPAVRAAG
GGGGGGGGGGGGGGGGGVGGGGAGGGAGGGRSPVRELDMGAAERSREPGSPRLTEVSPEL
KDRKEDAKGMEDEGQTKIKQRRSRTNFTLEQLNELERLFDETHYPDAFMREELSQRLGLS
EARVQVWFQNRRAKCRKQENQLHKGVLIGAASQFEACRVAPYVNVGALRMPFQQDSHCNV
TPLSFQVQAQLQLDSAVAHAHHHLHPHLAAHAPYMMFPAPPFGLPLATLAADSASAASVV
AAAAAAKTTSKNSSIADLRLKAKKHAAALGL

Sequence length

331

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (7)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATRIAL FIBRILLATION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, BASAL CELL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SHOX2-related disorder	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (55)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	25331797, 28977861		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	32647207	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	27138930, 30443179		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Fibrillation	Atrial fibrillation	Pubtator	30443179, 32976766, 34845933, 37028180	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Biliary Tract Neoplasms	Biliary tract neoplasms	Pubtator	27999621	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	32361006	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	26124144		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	24746361, 35414113	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	37170390	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	39991677	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	21047392, 21426551, 21694641, 22108652, 22555092, 23851611, 25331797, 26774146, 28977861, 29151944		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	39575407	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	27999621	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Diseases	Colonic disease	Pubtator	27660666	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	27660666	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	27660666, 29610456	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cornelia De Lange Syndrome	Cornelia De Lange Syndrome	BEFREE	9482898		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	39575407	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	32647207	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	27840009		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	27840009, 37170390	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	32361006	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	24248941		★★★★★ ★☆☆☆☆ Found in Text Mining only
Langer Mesomelic Dysplasia Syndrome	Langer Mesomelic Dysplasia Syndrome	BEFREE	24421874		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leri-Weill dyschondrosteosis	Leri-Weill Dyschondrosteosis	BEFREE	16141225, 24421874		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	23851611		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	21047392, 21694641, 26774146		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	21047392, 21694641, 34408226	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases Obstructive	Lung disease	Pubtator	21047392	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	21047392, 21426551, 21694641, 24026539, 31450918, 34408226, 37682182, 37811622, 40164346	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	32361006	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	26124144		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	21047392, 21426551, 21694641, 22108652, 22555092, 23851611, 25331797, 26774146, 28977861, 29151944		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	26124144, 30231884, 31431369		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	25331797, 26124144, 26774146		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	32361006	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	32361006	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	21047392, 21426551, 23851611, 24136974, 27840009		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	31480262	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	22555092		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	12963668		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	26124144		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pleural effusion disorder	Pleural effusion	BEFREE	24136974, 24386354		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	26124144, 30231884, 31431369		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	12963668		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	30626634		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	21047392	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	32361006	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	12963668		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Scleroderma Systemic	Systemic sclerosis	Pubtator	21047392	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sick Sinus Syndrome	Sick sinus syndrome	Pubtator	37028180	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	21694641	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	28069583		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	29213339, 29610456, 31486492	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Temporomandibular Joint Disorders	Temporomandibular Joint Disorders	BEFREE	27601064		★★★★★ ★☆☆☆☆ Found in Text Mining only

SHOX2 (SHOX homeobox 2)