Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	64579
Gene name	N-deacetylase and N-sulfotransferase 4
Gene symbol	NDST4
Synonyms (NCBI Gene)	N-HSSTN-HSST 4NDST-4NHSST4
Chromosome	4
Chromosome location	4q26

Show/Hide all (28)

miRTarBase ID	miRNA	Experiments	Reference
MIRT447634	hsa-miR-548n	PAR-CLIP	22100165
MIRT447633	hsa-miR-548az-5p	PAR-CLIP	22100165
MIRT447632	hsa-miR-548t-5p	PAR-CLIP	22100165
MIRT447631	hsa-miR-548l	PAR-CLIP	22100165
MIRT447630	hsa-miR-141-3p	PAR-CLIP	22100165
MIRT447629	hsa-miR-200a-3p	PAR-CLIP	22100165
MIRT450424	hsa-miR-302c-5p	PAR-CLIP	22100165
MIRT447634	hsa-miR-548n	PAR-CLIP	22100165
MIRT447633	hsa-miR-548az-5p	PAR-CLIP	22100165
MIRT447632	hsa-miR-548t-5p	PAR-CLIP	22100165
MIRT447631	hsa-miR-548l	PAR-CLIP	22100165
MIRT447630	hsa-miR-141-3p	PAR-CLIP	22100165
MIRT447629	hsa-miR-200a-3p	PAR-CLIP	22100165
MIRT447628	hsa-miR-526b-5p	PAR-CLIP	22100165
MIRT447634	hsa-miR-548n	PAR-CLIP	22100165
MIRT447633	hsa-miR-548az-5p	PAR-CLIP	22100165
MIRT447632	hsa-miR-548t-5p	PAR-CLIP	22100165
MIRT447631	hsa-miR-548l	PAR-CLIP	22100165
MIRT447630	hsa-miR-141-3p	PAR-CLIP	22100165
MIRT447629	hsa-miR-200a-3p	PAR-CLIP	22100165
MIRT450424	hsa-miR-302c-5p	PAR-CLIP	22100165
MIRT447634	hsa-miR-548n	PAR-CLIP	22100165
MIRT447633	hsa-miR-548az-5p	PAR-CLIP	22100165
MIRT447632	hsa-miR-548t-5p	PAR-CLIP	22100165
MIRT447631	hsa-miR-548l	PAR-CLIP	22100165
MIRT447630	hsa-miR-141-3p	PAR-CLIP	22100165
MIRT447629	hsa-miR-200a-3p	PAR-CLIP	22100165
MIRT447628	hsa-miR-526b-5p	PAR-CLIP	22100165

Show/Hide all (16)

GO ID	Ontology	Definition	Evidence
GO:0000139	Component	Golgi membrane	IEA
GO:0003824	Function	Catalytic activity	IEA
GO:0005794	Component	Golgi apparatus	IBA
GO:0005794	Component	Golgi apparatus	IEA
GO:0008146	Function	Sulfotransferase activity	IEA
GO:0015012	Process	Heparan sulfate proteoglycan biosynthetic process	IBA
GO:0015012	Process	Heparan sulfate proteoglycan biosynthetic process	IEA
GO:0015016	Function	Heparan sulfate N-sulfotransferase activity	IBA
GO:0015016	Function	Heparan sulfate N-sulfotransferase activity	IEA
GO:0016020	Component	Membrane	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0019213	Function	Deacetylase activity	IBA
GO:0019213	Function	Deacetylase activity	IEA
GO:0030210	Process	Heparin proteoglycan biosynthetic process	IEA
GO:0050119	Function	N-acetylglucosamine deacetylase activity	IEA

MIM	HGNC	e!Ensembl
615039	20779	ENSG00000138653

Q9H3R1

Protein name

Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 4 (EC 2.8.2.8) (Glucosaminyl N-deacetylase/N-sulfotransferase 4) (NDST-4) (N-heparan sulfate sulfotransferase 4) (N-HSST 4) [Includes: Heparan sulfate N-deacetylase 4 (EC 3.-.-.-); Heparan sulf

Protein function

Essential bifunctional enzyme that catalyzes both the N-deacetylation and the N-sulfation of glucosamine (GlcNAc) of the glycosaminoglycan in heparan sulfate. Modifies the GlcNAc-GlcA disaccharide repeating sugar backbone to make N-sulfated hepa

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF12062	HSNSD	20 → 505	heparan sulfate-N-deacetylase	Family
PF00685	Sulfotransfer_1	594 → 857	Sulfotransferase domain	Domain

Sequence

MNLIVKLRRSFRTLIVLLATFCLVSIVISAYFLYSGYKQEMTLIETTAEAECTDIKILPY
RSMELKTVKPIDTSKTDPTVLLFVESQYSQLGQDIIAILESSRFQYHMVIAPGKGDIPPL
TDNGKGKYTLVIYENILKYVSMDSWNRELLEKYCVEYSVSIIGFHKANENSLPSTQLKGF
PLNLFNNLALKDCFVNPQSPLLHITKAPKVEKGPLPGEDWTIFQYNHSTYQPVLLTELQT
EKSLSSLSSKTLFATVIQDLGLHDGIQRVLFGNNLNFWLHKLIFIDAISFLSGKRLTLSL
DRYILVDIDDIFVGKEGTRMNVKDVKALLETQNLLRTQVANFTFNLGFSGKFYHTGTEEE
DEGDDLLLRSVDEFWWFPHMWSHMQPHLFHNESSLVEQMILNKEFALEHGIPINMGYAVA
PHHSGVYPVHIQLYAAWKKVWGIQVTSTEEYPHLKPARYRKGFIHNSIMVLPRQTCGLFT
HTIFYKEYPGGPQELDKSIRGGELFLTILLNPISIFMTHLSNYGNDRLGLYTFVNLVNFV
QSWTNLKLQTLPPVQLAHQYFELFPEQKDPLWQNPCDDKRHKDIWSREKTCDHLPKFLVI
GPQKTGTTALYLFLLMHPSIISNLPSPKTFEEVQFFNGNNYHKGIDWYMDFFPTPSNTTS
DFLFEKSANYFHSEEAPRRAASLVPKAKIITILIDPSDRAYSWYQHQRSHEDPAALRFNF
YEVISTGHWAPSDLKTLQRRCLVPGWYAVHIERWLTYFATSQLLIIDGQQLRSDPATVMD
EVQKFLGVTPRYNYSEALTFDPQKGFWCQLLEGGKTKCLGKSKGRKYPPMDPESRTFLSN
YYRDHNVELSKLLHRLGQPLPSWLRQELQKVR

Sequence length

872

Interactions

View interactions

	KEGG		Reactome
	Glycosaminoglycan biosynthesis - heparan sulfate / heparin Metabolic pathways		HS-GAG biosynthesis

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (7)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC LARYNGITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CIRRHOSIS OF LIVER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, KNEE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESTLESS LEGS SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (14)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Bipolar Disorder	Bipolar disorder	Pubtator	27112568	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Exstrophy	Bladder exstrophy	Pubtator	37509153	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	23825612, 27793051		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	23825612	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	22843503		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	22843503		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	22843503		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	22843503	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Language Disorders	Language Disorders	BEFREE	24024963		★★★★★ ★☆☆☆☆ Found in Text Mining only
Language Disorders	Language development disorders	Pubtator	24024963	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	29662167		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	23825612		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	23825612, 27793051		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	29662167		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

NDST4 (N-deacetylase and N-sulfotransferase 4)