ARRDC5 (arrestin domain containing 5)

Gene

• Entrez ID: 645432
• Gene name: Arrestin domain containing 5
• Gene symbol: ARRDC5
• Synonyms (NCBI Gene): -
• Chromosome: 19
• Chromosome location: 19p13.3

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT801012	hsa-miR-1245	CLIP-seq
MIRT801013	hsa-miR-3663-5p	CLIP-seq
MIRT801014	hsa-miR-371-5p	CLIP-seq
MIRT801015	hsa-miR-371b-5p	CLIP-seq
MIRT801016	hsa-miR-3929	CLIP-seq
MIRT801017	hsa-miR-4419b	CLIP-seq
MIRT801018	hsa-miR-4478	CLIP-seq
MIRT801019	hsa-miR-4505	CLIP-seq
MIRT801020	hsa-miR-4691-5p	CLIP-seq
MIRT801021	hsa-miR-4731-5p	CLIP-seq
MIRT801022	hsa-miR-4771	CLIP-seq
MIRT801023	hsa-miR-486-3p	CLIP-seq
MIRT801024	hsa-miR-513c	CLIP-seq
MIRT801025	hsa-miR-514b-5p	CLIP-seq
MIRT1936537	hsa-miR-1321	CLIP-seq
MIRT1936538	hsa-miR-3162-5p	CLIP-seq
MIRT1936539	hsa-miR-3175	CLIP-seq
MIRT1936540	hsa-miR-4728-5p	CLIP-seq
MIRT1936541	hsa-miR-4739	CLIP-seq
MIRT1936542	hsa-miR-4756-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005737	Component	Cytoplasm	IBA
GO:0005768	Component	Endosome	IBA
GO:0005886	Component	Plasma membrane	IBA
GO:0007283	Process	Spermatogenesis	IEA
GO:0007283	Process	Spermatogenesis	ISS
GO:0015031	Process	Protein transport	IBA
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	ISS
GO:0030154	Process	Cell differentiation	IEA

Other IDs

• MIM: 620944
• HGNC: 31407
• e!Ensembl: ENSG00000205784

Protein

• UniProt ID: A6NEK1
• Protein name: Arrestin domain-containing protein 5
• Protein function: Plays an essential role in spermatogenesis. May be involved in the anchoring of the sperm head to the tail during spermatogenesis by affecting SEC22A-mediated SUN5 and NDC1 transport and localization.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00339	Arrestin_N	21 → 160	Arrestin (or S-antigen), N-terminal domain	Domain
  PF02752	Arrestin_C	184 → 321	Arrestin (or S-antigen), C-terminal domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Testis-enriched. {ECO:0000269|PubMed:37069147}.
• Sequence:

  MGDREECLSTPQPPMSVVKSIELVLPEDRIYLAGSSIKGQVILTLNSTLVDPIVKVELVG
  RGYVEWSEEAGASCDYSRNVICNNKADYVHKTKTFPVEDNWLSAGSHTFDFHFNLPPRLP
  STFTSKFGHVFYFVQASCMGREHILAKKRMYLLVQGTSTFHKETPFQNPLFVEAEEKVSY
  NCCRQGTVCLQIQMERNTFTPGEKVVFTTEINNQTSKCIKTVVFALYAHIQYEGFTPSAE
  RRSRLDSSELLRQEANTPVTRFNTTKVVSTFNLPLLLSVSSSTQDGEIMHTRYELVTTVH
  LPWSLTSLKAKVPIIITSASVDSAICQLSEDGVLPVNPDHQN

• Sequence length: 342

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
PANCREATIC CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Carcinogenesis	Carcinogenesis	Pubtator	32671597	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	32671597	Associate	★☆☆☆☆ Found in Text Mining only