Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	645121
Gene name	Cyclin I family member 2
Gene symbol	CCNI2
Synonyms (NCBI Gene)	-
Chromosome	5
Chromosome location	5q31.1

Show/Hide all (41)

miRTarBase ID	miRNA	Experiments
MIRT872205	hsa-miR-1273g	CLIP-seq
MIRT872206	hsa-miR-1302	CLIP-seq
MIRT872207	hsa-miR-29a	CLIP-seq
MIRT872208	hsa-miR-29b	CLIP-seq
MIRT872209	hsa-miR-29c	CLIP-seq
MIRT872210	hsa-miR-3122	CLIP-seq
MIRT872211	hsa-miR-3199	CLIP-seq
MIRT872212	hsa-miR-3913-5p	CLIP-seq
MIRT872213	hsa-miR-4259	CLIP-seq
MIRT872214	hsa-miR-4298	CLIP-seq
MIRT872215	hsa-miR-4425	CLIP-seq
MIRT872216	hsa-miR-4515	CLIP-seq
MIRT872217	hsa-miR-4690-5p	CLIP-seq
MIRT872218	hsa-miR-4703-3p	CLIP-seq
MIRT872219	hsa-miR-4715-5p	CLIP-seq
MIRT872220	hsa-miR-4757-5p	CLIP-seq
MIRT872221	hsa-miR-671-5p	CLIP-seq
MIRT2195733	hsa-miR-4720-5p	CLIP-seq
MIRT2195734	hsa-miR-4799-3p	CLIP-seq
MIRT2446510	hsa-miR-1207-3p	CLIP-seq
MIRT2446511	hsa-miR-4323	CLIP-seq
MIRT2498948	hsa-miR-1236	CLIP-seq
MIRT2498949	hsa-miR-1910	CLIP-seq
MIRT2498950	hsa-miR-204	CLIP-seq
MIRT2498951	hsa-miR-211	CLIP-seq
MIRT2498952	hsa-miR-3180-5p	CLIP-seq
MIRT2498953	hsa-miR-3617	CLIP-seq
MIRT2498954	hsa-miR-4755-5p	CLIP-seq
MIRT2498955	hsa-miR-520a-5p	CLIP-seq
MIRT2498956	hsa-miR-525-5p	CLIP-seq
MIRT2498957	hsa-miR-623	CLIP-seq
MIRT2498958	hsa-miR-641	CLIP-seq
MIRT2498959	hsa-miR-7	CLIP-seq
MIRT2498948	hsa-miR-1236	CLIP-seq
MIRT2498950	hsa-miR-204	CLIP-seq
MIRT2498951	hsa-miR-211	CLIP-seq
MIRT2498952	hsa-miR-3180-5p	CLIP-seq
MIRT2498954	hsa-miR-4755-5p	CLIP-seq
MIRT2498955	hsa-miR-520a-5p	CLIP-seq
MIRT2498956	hsa-miR-525-5p	CLIP-seq
MIRT2498957	hsa-miR-623	CLIP-seq

Show/Hide all (5)

GO ID	Ontology	Definition	Evidence
GO:0000082	Process	G1/S transition of mitotic cell cycle	IBA
GO:0000307	Component	Cyclin-dependent protein kinase holoenzyme complex	IBA
GO:0005634	Component	Nucleus	IBA
GO:0005737	Component	Cytoplasm	IBA
GO:0016538	Function	Cyclin-dependent protein serine/threonine kinase regulator activity	IBA

MIM	HGNC	e!Ensembl
620419	33869	ENSG00000205089

Q6ZMN8

Protein name

Cyclin-I2

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00134	Cyclin_N	141 → 248	Cyclin, N-terminal domain	Domain

Sequence

MASGAQLPPQPSSSEVSAVQSPGGRPGAGLEETALGVPLPPSPGEAPLPRSNRSRCPGTR
QPGAASLHAASAAVPVRPRRGTAPAGKTADAVPAAAPEQAPRPAPQSRKPRNLEGDLDER
RLLCHLQLAQDREARLWRGGKPQDEICDAFEEVVLWLLRLQNTFYFSQSTFNLALTIFGR
LLISVKVKEKYLHCATITSLRLAAKVNEEEEFIPQVKDFTKHYGSDYSPNELLRMELAIL
DRLHWDLYIGTPLDFLTIFHALVVLSWPHVLELLPQRNPSLHVASLTRQLQHCMAGHQLL
QFKGSTLALVIITLELERLMPGWCAPISDLLKKAQVGDMQYSCCKELVMQQLRSLQSSSC
TDNFVSPAN

Sequence length

369

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHILDHOOD ONSET ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

CCNI2 (cyclin I family member 2)