Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	64506
Gene name	Cytoplasmic polyadenylation element binding protein 1
Gene symbol	CPEB1
Synonyms (NCBI Gene)	CPE-BP1CPEBCPEB-1h-CPEBhCPEB-1
Chromosome	15
Chromosome location	15q25.2
Summary	This gene encodes a member of the cytoplasmic polyadenylation element binding protein family. This highly conserved protein binds to a specific RNA sequence, called the cytoplasmic polyadenylation element, found in the 3` untranslated region of some mRNAs

133

Show/Hide all (133)

miRTarBase ID	miRNA	Experiments	Reference
MIRT053584	hsa-miR-101-3p	SHG44	23788032
MIRT054121	hsa-let-7b-5p	Luciferase reporter assayMicroarrayqRT-PCR	22995917
MIRT731347	hsa-miR-25-3p	Luciferase reporter assay	25923408
MIRT731347	hsa-miR-25-3p	Luciferase reporter assay	25923408
MIRT567974	hsa-miR-107	qRT-PCRWestern blot	26497556
MIRT567974	hsa-miR-107	qRT-PCRWestern blot	26497556
MIRT905854	hsa-miR-1305	CLIP-seq
MIRT905855	hsa-miR-3671	CLIP-seq
MIRT905856	hsa-miR-607	CLIP-seq
MIRT905857	hsa-miR-22	CLIP-seq
MIRT905858	hsa-miR-320a	CLIP-seq
MIRT905859	hsa-miR-320b	CLIP-seq
MIRT905860	hsa-miR-320c	CLIP-seq
MIRT905861	hsa-miR-320d	CLIP-seq
MIRT905862	hsa-miR-361-3p	CLIP-seq
MIRT905863	hsa-miR-3679-3p	CLIP-seq
MIRT905864	hsa-miR-409-3p	CLIP-seq
MIRT905865	hsa-miR-4429	CLIP-seq
MIRT905866	hsa-miR-4446-5p	CLIP-seq
MIRT905867	hsa-miR-4719	CLIP-seq
MIRT905868	hsa-miR-4755-3p	CLIP-seq
MIRT905863	hsa-miR-3679-3p	CLIP-seq
MIRT905866	hsa-miR-4446-5p	CLIP-seq
MIRT905863	hsa-miR-3679-3p	CLIP-seq
MIRT905866	hsa-miR-4446-5p	CLIP-seq
MIRT905863	hsa-miR-3679-3p	CLIP-seq
MIRT905866	hsa-miR-4446-5p	CLIP-seq
MIRT905863	hsa-miR-3679-3p	CLIP-seq
MIRT905866	hsa-miR-4446-5p	CLIP-seq
MIRT905863	hsa-miR-3679-3p	CLIP-seq
MIRT905866	hsa-miR-4446-5p	CLIP-seq
MIRT905863	hsa-miR-3679-3p	CLIP-seq
MIRT905866	hsa-miR-4446-5p	CLIP-seq
MIRT905863	hsa-miR-3679-3p	CLIP-seq
MIRT905866	hsa-miR-4446-5p	CLIP-seq
MIRT2204575	hsa-miR-130a	CLIP-seq
MIRT2204576	hsa-miR-130b	CLIP-seq
MIRT2204577	hsa-miR-19a	CLIP-seq
MIRT2204578	hsa-miR-19b	CLIP-seq
MIRT2204579	hsa-miR-301a	CLIP-seq
MIRT2204580	hsa-miR-301b	CLIP-seq
MIRT2204581	hsa-miR-3137	CLIP-seq
MIRT2204582	hsa-miR-3666	CLIP-seq
MIRT905863	hsa-miR-3679-3p	CLIP-seq
MIRT2204583	hsa-miR-4291	CLIP-seq
MIRT2204584	hsa-miR-4295	CLIP-seq
MIRT905866	hsa-miR-4446-5p	CLIP-seq
MIRT2204585	hsa-miR-454	CLIP-seq
MIRT2204586	hsa-miR-4693-3p	CLIP-seq
MIRT905867	hsa-miR-4719	CLIP-seq
MIRT2204587	hsa-miR-4797-5p	CLIP-seq
MIRT2204588	hsa-miR-513b	CLIP-seq
MIRT2204589	hsa-miR-518a-5p	CLIP-seq
MIRT2204590	hsa-miR-519a	CLIP-seq
MIRT2204591	hsa-miR-519b-3p	CLIP-seq
MIRT2204592	hsa-miR-519c-3p	CLIP-seq
MIRT2204593	hsa-miR-527	CLIP-seq
MIRT2204594	hsa-miR-545	CLIP-seq
MIRT905863	hsa-miR-3679-3p	CLIP-seq
MIRT905866	hsa-miR-4446-5p	CLIP-seq
MIRT905863	hsa-miR-3679-3p	CLIP-seq
MIRT905866	hsa-miR-4446-5p	CLIP-seq
MIRT2204575	hsa-miR-130a	CLIP-seq
MIRT2204576	hsa-miR-130b	CLIP-seq
MIRT2204579	hsa-miR-301a	CLIP-seq
MIRT2204580	hsa-miR-301b	CLIP-seq
MIRT2204582	hsa-miR-3666	CLIP-seq
MIRT2204584	hsa-miR-4295	CLIP-seq
MIRT2204585	hsa-miR-454	CLIP-seq
MIRT2507993	hsa-miR-1271	CLIP-seq
MIRT2204575	hsa-miR-130a	CLIP-seq
MIRT2204576	hsa-miR-130b	CLIP-seq
MIRT2507994	hsa-miR-1323	CLIP-seq
MIRT2507995	hsa-miR-182	CLIP-seq
MIRT2204577	hsa-miR-19a	CLIP-seq
MIRT2204578	hsa-miR-19b	CLIP-seq
MIRT2507996	hsa-miR-298	CLIP-seq
MIRT2204579	hsa-miR-301a	CLIP-seq
MIRT2204580	hsa-miR-301b	CLIP-seq
MIRT2507997	hsa-miR-3117-5p	CLIP-seq
MIRT2507998	hsa-miR-3184	CLIP-seq
MIRT2204582	hsa-miR-3666	CLIP-seq
MIRT2507999	hsa-miR-423-5p	CLIP-seq
MIRT2508000	hsa-miR-4266	CLIP-seq
MIRT2204583	hsa-miR-4291	CLIP-seq
MIRT2204584	hsa-miR-4295	CLIP-seq
MIRT2508001	hsa-miR-4473	CLIP-seq
MIRT2204585	hsa-miR-454	CLIP-seq
MIRT2508002	hsa-miR-4671-3p	CLIP-seq
MIRT2508003	hsa-miR-4688	CLIP-seq
MIRT2508004	hsa-miR-4695-5p	CLIP-seq
MIRT2508005	hsa-miR-4779	CLIP-seq
MIRT2204589	hsa-miR-518a-5p	CLIP-seq
MIRT2204590	hsa-miR-519a	CLIP-seq
MIRT2204591	hsa-miR-519b-3p	CLIP-seq
MIRT2204592	hsa-miR-519c-3p	CLIP-seq
MIRT2204593	hsa-miR-527	CLIP-seq
MIRT2204594	hsa-miR-545	CLIP-seq
MIRT2508006	hsa-miR-548o	CLIP-seq
MIRT2508007	hsa-miR-9	CLIP-seq
MIRT2508008	hsa-miR-96	CLIP-seq
MIRT2507993	hsa-miR-1271	CLIP-seq
MIRT2204575	hsa-miR-130a	CLIP-seq
MIRT2204576	hsa-miR-130b	CLIP-seq
MIRT2507994	hsa-miR-1323	CLIP-seq
MIRT2507995	hsa-miR-182	CLIP-seq
MIRT2204577	hsa-miR-19a	CLIP-seq
MIRT2204578	hsa-miR-19b	CLIP-seq
MIRT2507996	hsa-miR-298	CLIP-seq
MIRT2204579	hsa-miR-301a	CLIP-seq
MIRT2204580	hsa-miR-301b	CLIP-seq
MIRT2507997	hsa-miR-3117-5p	CLIP-seq
MIRT2507998	hsa-miR-3184	CLIP-seq
MIRT2204582	hsa-miR-3666	CLIP-seq
MIRT2507999	hsa-miR-423-5p	CLIP-seq
MIRT2508000	hsa-miR-4266	CLIP-seq
MIRT2204583	hsa-miR-4291	CLIP-seq
MIRT2204584	hsa-miR-4295	CLIP-seq
MIRT2508001	hsa-miR-4473	CLIP-seq
MIRT2204585	hsa-miR-454	CLIP-seq
MIRT2508002	hsa-miR-4671-3p	CLIP-seq
MIRT2508003	hsa-miR-4688	CLIP-seq
MIRT2508004	hsa-miR-4695-5p	CLIP-seq
MIRT2508005	hsa-miR-4779	CLIP-seq
MIRT2204589	hsa-miR-518a-5p	CLIP-seq
MIRT2204590	hsa-miR-519a	CLIP-seq
MIRT2204591	hsa-miR-519b-3p	CLIP-seq
MIRT2204592	hsa-miR-519c-3p	CLIP-seq
MIRT2204593	hsa-miR-527	CLIP-seq
MIRT2204594	hsa-miR-545	CLIP-seq
MIRT2508006	hsa-miR-548o	CLIP-seq
MIRT2508007	hsa-miR-9	CLIP-seq
MIRT2508008	hsa-miR-96	CLIP-seq

Show/Hide all (2)

Transcription factor	Regulation	Reference
EED	Unknown	23788032
EZH2	Unknown	23788032

Show/Hide all (40)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000900	Function	MRNA regulatory element binding translation repressor activity	IBA
GO:0000900	Function	MRNA regulatory element binding translation repressor activity	ISS
GO:0000932	Component	P-body	IEA
GO:0003676	Function	Nucleic acid binding	IEA
GO:0003723	Function	RNA binding	IEA
GO:0003730	Function	MRNA 3'-UTR binding	IBA
GO:0003730	Function	MRNA 3'-UTR binding	IEA
GO:0005515	Function	Protein binding	IPI	28383716
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	28383716
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005829	Component	Cytosol	IDA
GO:0006397	Process	MRNA processing	IEA
GO:0006412	Process	Translation	IEA
GO:0006417	Process	Regulation of translation	IEA
GO:0008135	Function	Translation factor activity, RNA binding	IBA
GO:0014069	Component	Postsynaptic density	IEA
GO:0016020	Component	Membrane	IEA
GO:0017148	Process	Negative regulation of translation	IEA
GO:0030425	Component	Dendrite	IEA
GO:0031440	Process	Regulation of mRNA 3'-end processing	IDA	28383716
GO:0032869	Process	Cellular response to insulin stimulus	IDA	18752464
GO:0035925	Function	MRNA 3'-UTR AU-rich region binding	ISS
GO:0042995	Component	Cell projection	IEA
GO:0043005	Component	Neuron projection	IBA
GO:0043022	Function	Ribosome binding	IBA
GO:0045182	Function	Translation regulator activity	IEA
GO:0045202	Component	Synapse	IBA
GO:0045202	Component	Synapse	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0071230	Process	Cellular response to amino acid stimulus	ISS
GO:0071456	Process	Cellular response to hypoxia	IDA	18752464
GO:1990904	Component	Ribonucleoprotein complex	IEA
GO:2000766	Process	Negative regulation of cytoplasmic translation	IBA
GO:2000766	Process	Negative regulation of cytoplasmic translation	IMP	18752464

MIM	HGNC	e!Ensembl
607342	21744	ENSG00000214575

Q9BZB8

Protein name

Cytoplasmic polyadenylation element-binding protein 1 (CPE-BP1) (CPE-binding protein 1) (h-CPEB) (hCPEB-1)

Protein function

Sequence-specific RNA-binding protein that regulates mRNA cytoplasmic polyadenylation and translation initiation during oocyte maturation, early development and at postsynapse sites of neurons. Binds to the cytoplasmic polyadenylation element (C

PDB

2M13 , 2MKE , 2MKH , 2MKK , 2N1O

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF16368	CEBP1_N	1 → 307	Cytoplasmic polyadenylation element-binding protein 1 N-terminus	Family
PF16367	RRM_7	310 → 410	RNA recognition motif	Domain
PF16366	CEBP_ZZ	502 → 559	Cytoplasmic polyadenylation element-binding protein ZZ domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Isoform 1 is expressed in immature oocytes, ovary, brain and heart. Isoform 2 is expressed in brain and heart. Isoform 3 and isoform 4 are expressed in brain. Expressed in breast tumors and several tumor cell lines. {ECO:0000269|PubMed

Sequence

MALSLEEEAGRIKDCWDNQEAPALSTCSNANIFRRINAILDNSLDFSRVCTTPINRGIHD
HLPDFQDSEETVTSRMLFPTSAQESSRGLPDANDLCLGLQSLSLTGWDRPWSTQDSDSSA
QSSTHSVLSMLHNPLGNVLGKPPLSFLPLDPLGSDLVDKFPAPSVRGSRLDTRPILDSRS
SSPSDSDTSGFSSGSDHLSDLISSLRISPPLPFLSLSGGGPRDPLKMGVGSRMDQEQAAL
AAVTPSPTSASKRWPGASVWPSWDLLEAPKDPFSIEREARLHRQAAAVNEATCTWSGQLP
PRNYKNPIYSCKVFLGGVPWDITEAGLVNTFRVFGSLSVEWPGKDGKHPRCPPKGNMPKG
YVYLVFELEKSVRSLLQACSHDPLSPDGLSEYYFKMSSRRMRCKEVQVIPWVLADSNFVR
SPSQRLDPSRTVFVGALHGMLNAEALAAILNDLFGGVVYAGIDTDKHKYPIGSGRVTFNN
QRSYLKAVSAAFVEIKTTKFTKKVQIDPYLEDSLCHICSSQPGPFFCRDQVCFKYFCRSC
WHWRHSMEGLRHHSPLMRNQKNRDSS

Sequence length

566

Interactions

View interactions

	KEGG
	Oocyte meiosis Progesterone-mediated oocyte maturation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA, LYMPHOCYTIC, CHRONIC, B-CELL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (44)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	24398667		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amenorrhea	Amenorrhea	Pubtator	32354341	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	29242136		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	29242136		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	28252647		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	26411364		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	36131924	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	25230976	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	CTD_human_DG	20062064		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	20921022	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	33892791	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	36131924	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	30763690		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	29923214		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fragile X Syndrome	Fragile X Syndrome	BEFREE	24141422, 29242136		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	23360795, 30106109		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	27142352	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	23360795, 30106109		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	23788032, 25216517, 27000226, 27256982		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	23788032, 26535664, 27256982	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	27142352	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	20062064	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	34586830	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Infertility Male	Male infertility	Pubtator	21601192	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	38492610	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	30237545		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	27000226		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	26411364		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	29923214		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	22052064		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19161537, 27256982, 30237545		★★★★★ ★☆☆☆☆ Found in Text Mining only
Memory Disorders	Memory Disorders	BEFREE	29242136		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental impairment	Mental Depression	BEFREE	30763690		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	19161537, 22542725, 23360795, 23788032, 25686251, 27000226, 27256982		★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	25068488		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	24975429		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Dysgenesis 2	Ovarian dysgenesis	Pubtator	21256485	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Failure, Premature	Ovarian Failure	BEFREE	27003306, 27301361		★★★★★ ★☆☆☆☆ Found in Text Mining only
Portal Hypertension	Portal Hypertension	BEFREE	26627607		★★★★★ ★☆☆☆☆ Found in Text Mining only
Premature Menopause	Premature Menopause	BEFREE	27003306, 27301361		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary physiologic amenorrhea	Physiologic Amenorrhea	BEFREE	27003306		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	GWASCAT_DG	26198764, 28991256, 30285260, 31374203		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Carcinoma	Stomach Carcinoma	BEFREE	22052064		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomatitis	Stomatitis	Pubtator	25218607	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

CPEB1 (cytoplasmic polyadenylation element binding protein 1)