TPSB2 (tryptase beta 2)

Gene

• Entrez ID: 64499
• Gene name: Tryptase beta 2
• Gene symbol: TPSB2
• Synonyms (NCBI Gene): TPS2, tryptaseB, tryptaseC
• Chromosome: 16
• Chromosome location: 16p13.3
• Summary: Tryptases comprise a family of trypsin-like serine proteases, the peptidase family S1. Tryptases are enzymatically active only as heparin-stabilized tetramers, and they are resistant to all known endogenous proteinase inhibitors. Several tryptase genes ar

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1450407	hsa-miR-1207-5p	CLIP-seq
MIRT1450408	hsa-miR-3179	CLIP-seq
MIRT1450409	hsa-miR-3202	CLIP-seq
MIRT1450410	hsa-miR-3664-3p	CLIP-seq
MIRT1450411	hsa-miR-4436a	CLIP-seq
MIRT1450412	hsa-miR-4688	CLIP-seq
MIRT1450413	hsa-miR-4763-3p	CLIP-seq
MIRT1450414	hsa-miR-486-3p	CLIP-seq
MIRT1450415	hsa-miR-510	CLIP-seq
MIRT2134642	hsa-miR-1909	CLIP-seq
MIRT2134643	hsa-miR-2278	CLIP-seq
MIRT2134644	hsa-miR-24	CLIP-seq
MIRT2134645	hsa-miR-4283	CLIP-seq
MIRT2134646	hsa-miR-4437	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004252	Function	Serine-type endopeptidase activity	IBA
GO:0004252	Function	Serine-type endopeptidase activity	IEA
GO:0004252	Function	Serine-type endopeptidase activity	NAS	9920877
GO:0005515	Function	Protein binding	IPI	14670919
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0006508	Process	Proteolysis	IBA
GO:0006508	Process	Proteolysis	IEA
GO:0008233	Function	Peptidase activity	IEA
GO:0008236	Function	Serine-type peptidase activity	IEA
GO:0008236	Function	Serine-type peptidase activity	TAS	2203827
GO:0016787	Function	Hydrolase activity	IEA
GO:0031012	Component	Extracellular matrix	HDA	27559042

Other IDs

• MIM: 191081
• HGNC: 14120
• e!Ensembl: ENSG00000197253

Protein

• UniProt ID: P20231
• Protein name: Tryptase beta-2 (Tryptase-2) (EC 3.4.21.59) (Tryptase II)
• Protein function: Tryptase is the major neutral protease present in mast cells and is secreted upon the coupled activation-degranulation response of this cell type. May play a role in innate immunity.
• PDB: 1A0L, 2BM2, 2FPZ, 2FS8, 2FS9, 2FWW, 2FXR, 2GDD, 2ZA5, 3V7T
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00089	Trypsin	31 → 267	Trypsin	Domain

• Sequence:

  MLNLLLLALPVLASRAYAAPAPGQALQRVGIVGGQEAPRSKWPWQVSLRVHGPYWMHFCG
  GSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGA
  DIALLELEEPVNVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKV
  PIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAG
  VVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPKKP

• Sequence length: 275

Pathways

KEGG:

Influenza A

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
URTICARIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Asthma	Asthma	Pubtator	35550122, 37241840	Associate	★☆☆☆☆ Found in Text Mining only
Dejerine-Sottas Disease (disorder)	Charcot-Marie-Tooth disease	BEFREE	25797204		★☆☆☆☆ Found in Text Mining only
Dermatitis Herpetiformis	Dermatitis herpetiformis	Pubtator	22991566	Associate	★☆☆☆☆ Found in Text Mining only
Hypereosinophilic Syndrome	Hypereosinophilic syndrome	Pubtator	34321876	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	34689792	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Calculi	Kidney stone	BEFREE	30584463		★☆☆☆☆ Found in Text Mining only
Mastocytosis	Mastocytosis	LHGDN	17449330		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	29137398, 30728907		★☆☆☆☆ Found in Text Mining only
Nephrolithiasis	Nephrolithiasis	BEFREE	30584463		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	37511292	Stimulate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	37511292	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis Hip	Osteoarthritis	Pubtator	37511292	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	34321876	Associate	★☆☆☆☆ Found in Text Mining only