Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	6449
Gene name	Small glutamine rich tetratricopeptide repeat co-chaperone alpha
Gene symbol	SGTA
Synonyms (NCBI Gene)	SGTSGT1VpualphaSGThSGT
Chromosome	19
Chromosome location	19p13.3
Summary	This gene encodes a protein which is capable of interacting with the major nonstructural protein of parvovirus H-1 and 70-kDa heat shock cognate protein; however, its function is not known. Since this transcript is expressed ubiquitously in various tissue

223

Show/Hide all (223)

miRTarBase ID	miRNA	Experiments	Reference
MIRT031542	hsa-miR-16-5p	Proteomics	18668040
MIRT047826	hsa-miR-30d-5p	CLASH	23622248
MIRT046945	hsa-miR-221-3p	CLASH	23622248
MIRT1343923	hsa-miR-1182	CLIP-seq
MIRT1343924	hsa-miR-1229	CLIP-seq
MIRT1343925	hsa-miR-1321	CLIP-seq
MIRT1343926	hsa-miR-138	CLIP-seq
MIRT1343927	hsa-miR-149	CLIP-seq
MIRT1343928	hsa-miR-3074-5p	CLIP-seq
MIRT1343929	hsa-miR-3131	CLIP-seq
MIRT1343930	hsa-miR-3154	CLIP-seq
MIRT1343931	hsa-miR-3166	CLIP-seq
MIRT1343932	hsa-miR-3188	CLIP-seq
MIRT1343933	hsa-miR-3202	CLIP-seq
MIRT1343934	hsa-miR-342-3p	CLIP-seq
MIRT1343935	hsa-miR-3649	CLIP-seq
MIRT1343936	hsa-miR-3652	CLIP-seq
MIRT1343937	hsa-miR-3662	CLIP-seq
MIRT1343938	hsa-miR-3663-5p	CLIP-seq
MIRT1343939	hsa-miR-3689a-3p	CLIP-seq
MIRT1343940	hsa-miR-3689c	CLIP-seq
MIRT1343941	hsa-miR-370	CLIP-seq
MIRT1343942	hsa-miR-4261	CLIP-seq
MIRT1343943	hsa-miR-4264	CLIP-seq
MIRT1343944	hsa-miR-4314	CLIP-seq
MIRT1343945	hsa-miR-4430	CLIP-seq
MIRT1343946	hsa-miR-4431	CLIP-seq
MIRT1343947	hsa-miR-4459	CLIP-seq
MIRT1343948	hsa-miR-4475	CLIP-seq
MIRT1343949	hsa-miR-4488	CLIP-seq
MIRT1343950	hsa-miR-4492	CLIP-seq
MIRT1343951	hsa-miR-4498	CLIP-seq
MIRT1343952	hsa-miR-4527	CLIP-seq
MIRT1343953	hsa-miR-4533	CLIP-seq
MIRT1343954	hsa-miR-4653-3p	CLIP-seq
MIRT1343955	hsa-miR-4667-5p	CLIP-seq
MIRT1343956	hsa-miR-4675	CLIP-seq
MIRT1343957	hsa-miR-4697-5p	CLIP-seq
MIRT1343958	hsa-miR-4700-5p	CLIP-seq
MIRT1343959	hsa-miR-4728-5p	CLIP-seq
MIRT1343960	hsa-miR-4731-5p	CLIP-seq
MIRT1343961	hsa-miR-4739	CLIP-seq
MIRT1343962	hsa-miR-4741	CLIP-seq
MIRT1343963	hsa-miR-4743	CLIP-seq
MIRT1343964	hsa-miR-4751	CLIP-seq
MIRT1343965	hsa-miR-4756-5p	CLIP-seq
MIRT1343966	hsa-miR-4779	CLIP-seq
MIRT1343967	hsa-miR-4795-5p	CLIP-seq
MIRT1343968	hsa-miR-4797-3p	CLIP-seq
MIRT1343969	hsa-miR-483-5p	CLIP-seq
MIRT1343970	hsa-miR-498	CLIP-seq
MIRT1343971	hsa-miR-549	CLIP-seq
MIRT1343972	hsa-miR-583	CLIP-seq
MIRT1343973	hsa-miR-611	CLIP-seq
MIRT1343974	hsa-miR-637	CLIP-seq
MIRT1343975	hsa-miR-639	CLIP-seq
MIRT1343976	hsa-miR-760	CLIP-seq
MIRT1343977	hsa-miR-762	CLIP-seq
MIRT1343978	hsa-miR-765	CLIP-seq
MIRT2101714	hsa-miR-224	CLIP-seq
MIRT1343931	hsa-miR-3166	CLIP-seq
MIRT2101715	hsa-miR-4252	CLIP-seq
MIRT2101716	hsa-miR-4269	CLIP-seq
MIRT1343946	hsa-miR-4431	CLIP-seq
MIRT2101717	hsa-miR-4434	CLIP-seq
MIRT1343947	hsa-miR-4459	CLIP-seq
MIRT2101718	hsa-miR-4516	CLIP-seq
MIRT2101719	hsa-miR-4531	CLIP-seq
MIRT2101720	hsa-miR-455-3p	CLIP-seq
MIRT2101721	hsa-miR-4651	CLIP-seq
MIRT1343963	hsa-miR-4743	CLIP-seq
MIRT1343966	hsa-miR-4779	CLIP-seq
MIRT2101722	hsa-miR-608	CLIP-seq
MIRT2326097	hsa-miR-1538	CLIP-seq
MIRT1343931	hsa-miR-3166	CLIP-seq
MIRT2326098	hsa-miR-3663-3p	CLIP-seq
MIRT1343939	hsa-miR-3689a-3p	CLIP-seq
MIRT1343940	hsa-miR-3689c	CLIP-seq
MIRT1343942	hsa-miR-4261	CLIP-seq
MIRT2326099	hsa-miR-4320	CLIP-seq
MIRT2326100	hsa-miR-4436a	CLIP-seq
MIRT1343947	hsa-miR-4459	CLIP-seq
MIRT1343959	hsa-miR-4728-5p	CLIP-seq
MIRT2326101	hsa-miR-4745-3p	CLIP-seq
MIRT1343966	hsa-miR-4779	CLIP-seq
MIRT1343967	hsa-miR-4795-5p	CLIP-seq
MIRT2326102	hsa-miR-489	CLIP-seq
MIRT2326103	hsa-miR-494	CLIP-seq
MIRT2326104	hsa-miR-665	CLIP-seq
MIRT1343978	hsa-miR-765	CLIP-seq
MIRT2394339	hsa-miR-4777-3p	CLIP-seq
MIRT1343941	hsa-miR-370	CLIP-seq
MIRT2459260	hsa-miR-626	CLIP-seq
MIRT1343941	hsa-miR-370	CLIP-seq
MIRT2459260	hsa-miR-626	CLIP-seq
MIRT2621736	hsa-miR-1200	CLIP-seq
MIRT2621737	hsa-miR-1207-3p	CLIP-seq
MIRT2621738	hsa-miR-1228	CLIP-seq
MIRT2621739	hsa-miR-1276	CLIP-seq
MIRT2621740	hsa-miR-1296	CLIP-seq
MIRT2621741	hsa-miR-1324	CLIP-seq
MIRT2621742	hsa-miR-1343	CLIP-seq
MIRT2326097	hsa-miR-1538	CLIP-seq
MIRT2621743	hsa-miR-1912	CLIP-seq
MIRT2621744	hsa-miR-2909	CLIP-seq
MIRT1343928	hsa-miR-3074-5p	CLIP-seq
MIRT2621745	hsa-miR-3124-3p	CLIP-seq
MIRT2621746	hsa-miR-3160-5p	CLIP-seq
MIRT2621747	hsa-miR-342-5p	CLIP-seq
MIRT2621748	hsa-miR-346	CLIP-seq
MIRT2621749	hsa-miR-34a	CLIP-seq
MIRT2621750	hsa-miR-34c-5p	CLIP-seq
MIRT2621751	hsa-miR-361-3p	CLIP-seq
MIRT2621752	hsa-miR-3648	CLIP-seq
MIRT1343935	hsa-miR-3649	CLIP-seq
MIRT2326098	hsa-miR-3663-3p	CLIP-seq
MIRT2621753	hsa-miR-3664-3p	CLIP-seq
MIRT2621754	hsa-miR-3670	CLIP-seq
MIRT1343941	hsa-miR-370	CLIP-seq
MIRT2621755	hsa-miR-3914	CLIP-seq
MIRT2621756	hsa-miR-3921	CLIP-seq
MIRT2621757	hsa-miR-4251	CLIP-seq
MIRT2101715	hsa-miR-4252	CLIP-seq
MIRT2621758	hsa-miR-4311	CLIP-seq
MIRT2326099	hsa-miR-4320	CLIP-seq
MIRT2621759	hsa-miR-4324	CLIP-seq
MIRT2621760	hsa-miR-4326	CLIP-seq
MIRT2621761	hsa-miR-4329	CLIP-seq
MIRT2621762	hsa-miR-4417	CLIP-seq
MIRT2621763	hsa-miR-4437	CLIP-seq
MIRT2621764	hsa-miR-4438	CLIP-seq
MIRT2621765	hsa-miR-4456	CLIP-seq
MIRT2621766	hsa-miR-449a	CLIP-seq
MIRT2621767	hsa-miR-449b	CLIP-seq
MIRT2621768	hsa-miR-4512	CLIP-seq
MIRT1343953	hsa-miR-4533	CLIP-seq
MIRT2621769	hsa-miR-4537	CLIP-seq
MIRT2621770	hsa-miR-4643	CLIP-seq
MIRT2621771	hsa-miR-4650-5p	CLIP-seq
MIRT2101721	hsa-miR-4651	CLIP-seq
MIRT2621772	hsa-miR-4653-5p	CLIP-seq
MIRT2621773	hsa-miR-4664-5p	CLIP-seq
MIRT2621774	hsa-miR-4674	CLIP-seq
MIRT2621775	hsa-miR-4687-3p	CLIP-seq
MIRT2621776	hsa-miR-4690-5p	CLIP-seq
MIRT2621777	hsa-miR-4715-3p	CLIP-seq
MIRT2621778	hsa-miR-4717-3p	CLIP-seq
MIRT2621779	hsa-miR-4727-5p	CLIP-seq
MIRT1343960	hsa-miR-4731-5p	CLIP-seq
MIRT2621780	hsa-miR-4738-3p	CLIP-seq
MIRT2621781	hsa-miR-4744	CLIP-seq
MIRT2326101	hsa-miR-4745-3p	CLIP-seq
MIRT2621782	hsa-miR-4746-3p	CLIP-seq
MIRT2621783	hsa-miR-4747-5p	CLIP-seq
MIRT2621784	hsa-miR-4763-5p	CLIP-seq
MIRT2621785	hsa-miR-4769-3p	CLIP-seq
MIRT2621786	hsa-miR-4777-5p	CLIP-seq
MIRT2621787	hsa-miR-501-3p	CLIP-seq
MIRT2621788	hsa-miR-502-3p	CLIP-seq
MIRT2621789	hsa-miR-516a-3p	CLIP-seq
MIRT2621790	hsa-miR-518d-5p	CLIP-seq
MIRT2621791	hsa-miR-519b-5p	CLIP-seq
MIRT2621792	hsa-miR-519c-5p	CLIP-seq
MIRT2621793	hsa-miR-520c-5p	CLIP-seq
MIRT2621794	hsa-miR-526a	CLIP-seq
MIRT2621795	hsa-miR-544b	CLIP-seq
MIRT1343971	hsa-miR-549	CLIP-seq
MIRT2621796	hsa-miR-570	CLIP-seq
MIRT2621797	hsa-miR-582-3p	CLIP-seq
MIRT1343972	hsa-miR-583	CLIP-seq
MIRT2101722	hsa-miR-608	CLIP-seq
MIRT2459260	hsa-miR-626	CLIP-seq
MIRT2621798	hsa-miR-658	CLIP-seq
MIRT2621799	hsa-miR-873	CLIP-seq
MIRT2621800	hsa-miR-942	CLIP-seq
MIRT2621736	hsa-miR-1200	CLIP-seq
MIRT2621741	hsa-miR-1324	CLIP-seq
MIRT2621742	hsa-miR-1343	CLIP-seq
MIRT2326097	hsa-miR-1538	CLIP-seq
MIRT2621743	hsa-miR-1912	CLIP-seq
MIRT1343928	hsa-miR-3074-5p	CLIP-seq
MIRT2621745	hsa-miR-3124-3p	CLIP-seq
MIRT2621746	hsa-miR-3160-5p	CLIP-seq
MIRT2621748	hsa-miR-346	CLIP-seq
MIRT2621751	hsa-miR-361-3p	CLIP-seq
MIRT2621752	hsa-miR-3648	CLIP-seq
MIRT1343935	hsa-miR-3649	CLIP-seq
MIRT2326098	hsa-miR-3663-3p	CLIP-seq
MIRT2621753	hsa-miR-3664-3p	CLIP-seq
MIRT1343941	hsa-miR-370	CLIP-seq
MIRT2621755	hsa-miR-3914	CLIP-seq
MIRT2621756	hsa-miR-3921	CLIP-seq
MIRT2621757	hsa-miR-4251	CLIP-seq
MIRT2101715	hsa-miR-4252	CLIP-seq
MIRT2621759	hsa-miR-4324	CLIP-seq
MIRT2621761	hsa-miR-4329	CLIP-seq
MIRT2621762	hsa-miR-4417	CLIP-seq
MIRT2621763	hsa-miR-4437	CLIP-seq
MIRT2621764	hsa-miR-4438	CLIP-seq
MIRT2621765	hsa-miR-4456	CLIP-seq
MIRT1343953	hsa-miR-4533	CLIP-seq
MIRT2621769	hsa-miR-4537	CLIP-seq
MIRT2621771	hsa-miR-4650-5p	CLIP-seq
MIRT2621772	hsa-miR-4653-5p	CLIP-seq
MIRT2621774	hsa-miR-4674	CLIP-seq
MIRT2621777	hsa-miR-4715-3p	CLIP-seq
MIRT2621779	hsa-miR-4727-5p	CLIP-seq
MIRT1343960	hsa-miR-4731-5p	CLIP-seq
MIRT2621780	hsa-miR-4738-3p	CLIP-seq
MIRT2326101	hsa-miR-4745-3p	CLIP-seq
MIRT2621783	hsa-miR-4747-5p	CLIP-seq
MIRT2621784	hsa-miR-4763-5p	CLIP-seq
MIRT2621785	hsa-miR-4769-3p	CLIP-seq
MIRT2621787	hsa-miR-501-3p	CLIP-seq
MIRT2621788	hsa-miR-502-3p	CLIP-seq
MIRT2621789	hsa-miR-516a-3p	CLIP-seq
MIRT2621795	hsa-miR-544b	CLIP-seq
MIRT1343971	hsa-miR-549	CLIP-seq
MIRT2621797	hsa-miR-582-3p	CLIP-seq
MIRT2459260	hsa-miR-626	CLIP-seq
MIRT2621798	hsa-miR-658	CLIP-seq
MIRT2621799	hsa-miR-873	CLIP-seq
MIRT2621800	hsa-miR-942	CLIP-seq

Show/Hide all (23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	14667819, 15708368, 16189514, 16580629, 16580632, 19615732, 21516116, 21988832, 23246001, 25036637, 25416956, 25910212, 26871637, 27107012, 31515488, 32296183, 36217029
GO:0005634	Component	Nucleus	IDA	16580629
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IDA	16580629
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA	23246001
GO:0005829	Component	Cytosol	TAS
GO:0006620	Process	Post-translational protein targeting to endoplasmic reticulum membrane	IBA
GO:0016020	Component	Membrane	IBA
GO:0016020	Component	Membrane	IDA	23246001
GO:0016020	Component	Membrane	IEA
GO:0036503	Process	ERAD pathway	IDA	23129660
GO:0042802	Function	Identical protein binding	IEA
GO:0042802	Function	Identical protein binding	IPI	25036637, 32296183
GO:0060090	Function	Molecular adaptor activity	IBA
GO:0071816	Process	Tail-anchored membrane protein insertion into ER membrane	IDA	25535373
GO:0072380	Component	TRC complex	IBA
GO:1904288	Function	BAT3 complex binding	IPI	23246001
GO:1904293	Process	Negative regulation of ERAD pathway	IDA	23129660
GO:1904294	Process	Positive regulation of ERAD pathway	IMP	23246001
GO:2000059	Process	Negative regulation of ubiquitin-dependent protein catabolic process	IDA	23129660
GO:2000060	Process	Positive regulation of ubiquitin-dependent protein catabolic process	IMP	23246001

MIM	HGNC	e!Ensembl
603419	10819	ENSG00000104969

O43765

Protein name

Small glutamine-rich tetratricopeptide repeat-containing protein alpha (Alpha-SGT) (Vpu-binding protein) (UBP)

Protein function

Co-chaperone that binds misfolded and hydrophobic patches-containing client proteins in the cytosol. Mediates their targeting to the endoplasmic reticulum but also regulates their sorting to the proteasome when targeting fails (PubMed:28104892).

PDB

2VYI , 4CPG , 4GOD , 4GOE , 4GOF

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF16546	SGTA_dimer	3 → 64	Homodimerisation domain of SGTA	Domain
PF13181	TPR_8	97 → 124	Tetratricopeptide repeat	Repeat
PF00515	TPR_1	125 → 158	Tetratricopeptide repeat	Repeat
PF00515	TPR_1	159 → 192	Tetratricopeptide repeat	Repeat

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous.

Sequence

MDNKKRLAYAIIQFLHDQLRHGGLSSDAQESLEVAIQCLETAFGVTVEDSDLALPQTLPE
IFEAAATGKEMPQDLRSPARTPPSEEDSAEAERLKTEGNEQMKVENFEAAVHFYGKAIEL
NPANAVYFCNRAAAYSKLGNYAGAVQDCERAICIDPAYSKAYGRMGLALSSLNKHVEAVA
YYKKALELDPDNETYKSNLKIAELKLREAPSPTGGVGSFDIAGLLNNPGFMSMASNLMNN
PQIQQLMSGMISGGNNPLGTPGTSPSQNDLASLIQAGQQFAQQMQQQNPELIEQLRSQIR
SRTPSASNDDQQE

Sequence length

313

Interactions

View interactions

	KEGG		Reactome
	Protein export		Insertion of tail-anchored proteins into the endoplasmic reticulum membrane

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (38)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	30527184		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoid Cystic Carcinoma	Adenocarcinoma	BEFREE	30527184		★★★★★ ★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	30527184		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	23433514, 26346258, 26658102		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	30527184		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	BEFREE	23443946		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	25027991		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	23443946		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	23839012	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	15733902		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	18256147	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Distal Myopathies	Distal myopathy	Pubtator	22090097	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Extraskeletal Myxoid Chondrosarcoma	Extraskeletal Myxoid Chondrosarcoma	BEFREE	30527184		★★★★★ ★☆☆☆☆ Found in Text Mining only
Genitourinary Cancer	Genitourinary Cancer	BEFREE	27480598		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	31241175		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	25240597, 31241175		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	22398292	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	15733902		★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	18332089	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	17005036	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy Body Disease	BEFREE	30741686		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	24551192	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	25027991		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	23443946		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	17942943, 26346258		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	23440515		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	23440515		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	30288347		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucoepidermoid Carcinoma	Mucoepidermoid Carcinoma	BEFREE	30527184		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	23433514, 23443946, 23609015, 23939810, 25027991, 25240597, 30288347, 31241175		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	27241213, 30741686		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	18332089, 23433514		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	18332089	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	17942943, 26346258		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	17942943		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	26658102	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	23939810		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	23440515		★★★★★ ★☆☆☆☆ Found in Text Mining only

SGTA (small glutamine rich tetratricopeptide repeat co-chaperone alpha)