SCG5 (secretogranin V)

Gene

• Entrez ID: 6447
• Gene name: Secretogranin V
• Gene symbol: SCG5
• Synonyms (NCBI Gene): 7B2, P7B2, SGNE1, SgV
• Chromosome: 15
• Chromosome location: 15q13.3
• Summary: This gene encodes a secreted chaperone protein that prevents the aggregation of other secreted proteins, including proteins that are associated with neurodegenerative and metabolic disease. The encoded protein may be best known for its role in the traffic

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1329336	hsa-miR-1911	CLIP-seq
MIRT1329337	hsa-miR-3140-3p	CLIP-seq
MIRT1329338	hsa-miR-376a	CLIP-seq
MIRT1329339	hsa-miR-376b	CLIP-seq
MIRT1329340	hsa-miR-4268	CLIP-seq
MIRT1329341	hsa-miR-431	CLIP-seq
MIRT1329342	hsa-miR-526b	CLIP-seq
MIRT1329343	hsa-miR-653	CLIP-seq
MIRT2321887	hsa-miR-23a	CLIP-seq
MIRT2321888	hsa-miR-23b	CLIP-seq
MIRT2321889	hsa-miR-23c	CLIP-seq
MIRT2321890	hsa-miR-3678-3p	CLIP-seq
MIRT2321891	hsa-miR-4317	CLIP-seq
MIRT2458905	hsa-miR-139-5p	CLIP-seq
MIRT2458906	hsa-miR-2277-3p	CLIP-seq
MIRT2458907	hsa-miR-3160-5p	CLIP-seq
MIRT2458908	hsa-miR-499a-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004857	Function	Enzyme inhibitor activity	IEA
GO:0004857	Function	Enzyme inhibitor activity	ISS
GO:0005515	Function	Protein binding	IPI	7913882, 25416956, 32296183
GO:0005525	Function	GTP binding	TAS	3134253
GO:0005576	Component	Extracellular region	IEA
GO:0005634	Component	Nucleus	IEA
GO:0006886	Process	Intracellular protein transport	IEA
GO:0006886	Process	Intracellular protein transport	ISS
GO:0007218	Process	Neuropeptide signaling pathway	IEA
GO:0016486	Process	Peptide hormone processing	IEA
GO:0016486	Process	Peptide hormone processing	ISS
GO:0030141	Component	Secretory granule	IEA
GO:0030141	Component	Secretory granule	ISS
GO:0030234	Function	Enzyme regulator activity	IBA
GO:0046883	Process	Regulation of hormone secretion	IBA
GO:0046883	Process	Regulation of hormone secretion	IEA
GO:0046883	Process	Regulation of hormone secretion	ISS
GO:0051082	Function	Unfolded protein binding	IDA	7913882

Other IDs

• MIM: 173120
• HGNC: 10816
• e!Ensembl: ENSG00000166922

Protein

• UniProt ID: P05408
• Protein name: Neuroendocrine protein 7B2 (Pituitary polypeptide) (Secretogranin V) (Secretogranin-5) (Secretory granule endocrine protein I) [Cleaved into: N-terminal peptide; C-terminal peptide]
• Protein function: Acts as a molecular chaperone for PCSK2/PC2, preventing its premature activation in the regulated secretory pathway. Binds to inactive PCSK2 in the endoplasmic reticulum and facilitates its transport from there to later compartments of the secre
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF05281	Secretogranin_V	21 → 161	Neuroendocrine protein 7B2 precursor (Secretogranin V)	Family

• Sequence:

  MVSRMVSTMLSGLLFWLASGWTPAFAYSPRTPDRVSEADIQRLLHGVMEQLGIARPRVEY
  PAHQAMNLVGPQSIEGGAHEGLQHLGPFGNIPNIVAELTGDNIPKDFSEDQGYPDPPNPC
  PVGKTADDGCLENTPDTAEFSREFQLHQHLFDPEHDYPGLGKWNKKLLYEKMKGGERRKR
  RSVNPYLQGQRLDNVVAKKSVPHFSDEDKDPE

• Sequence length: 212

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BREAST CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL ADENOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN-RECEPTOR NEGATIVE BREAST CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hereditary mixed polyposis syndrome	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MEDULLOBLASTOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN ENDOMETRIOID CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN SEROUS CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RECTUM CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acth-Independent Macronodular Adrenal Hyperplasia	Cushing`s Syndrome	BEFREE	14767469		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	17334394		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	CTD_human_DG	17334394		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	16313519	Associate	★☆☆☆☆ Found in Text Mining only
Anaplastic astrocytoma	Anaplastic Astrocytoma	BEFREE	21901745		★☆☆☆☆ Found in Text Mining only
Angelman Syndrome	Angelman Syndrome	BEFREE	2328988		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	21901745		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	2545336		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	17334394		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	CTD_human_DG	17334394		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	18084292, 24586997		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Carcinoma	Colorectal Cancer	CTD_human_DG	18084292		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	CTD_human_DG	18084292		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	33976257	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Desmoplastic Medulloblastoma	Medulloblastoma	CTD_human_DG	17334394		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	30078552		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	21901745		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	21901745		★☆☆☆☆ Found in Text Mining only
Hypophosphatemic Rickets, X-Linked Dominant	Hypophosphatemic Rickets	BEFREE	22886699		★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	17617923	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	2545336		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	17334394		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Medulloblastoma	Medulloblastoma	LHGDN	17334394		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Medulloblastoma	Medulloblastoma	CTD_human_DG	17334394		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Medullomyoblastoma	Medullomyoblastoma	CTD_human_DG	17334394		★☆☆☆☆ Found in Text Mining only
Melanotic medulloblastoma	Medulloblastoma	CTD_human_DG	17334394		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	25811241	Associate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	17617923		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	17617923	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	33164330	Associate	★☆☆☆☆ Found in Text Mining only
Pediatric Obesity	Childhood obesity	BEFREE	17617923		★☆☆☆☆ Found in Text Mining only
POLYPOSIS SYNDROME, HEREDITARY MIXED, 1	Hereditary mixed polyposis syndrome	BEFREE	18084292		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	20332665, 2545336		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	33892811	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	27776138		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	27776138	Associate	★☆☆☆☆ Found in Text Mining only
Vitamin D-Resistant Rickets, X-Linked	Vitamin D-Dependent Rickets	BEFREE	22886699		★☆☆☆☆ Found in Text Mining only