Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	6446
Gene name	Serum/glucocorticoid regulated kinase 1
Gene symbol	SGK1
Synonyms (NCBI Gene)	SGK
Chromosome	6
Chromosome location	6q23.2
Summary	This gene encodes a serine/threonine protein kinase that plays an important role in cellular stress response. This kinase activates certain potassium, sodium, and chloride channels, suggesting an involvement in the regulation of processes such as cell sur

Show/Hide all (1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs1171390403	T>C	Likely-pathogenic	Missense variant, coding sequence variant

539

Show/Hide all (539)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022117	hsa-miR-124-3p	Microarray	18668037
MIRT468242	hsa-miR-19a-3p	PAR-CLIP	23592263
MIRT468241	hsa-miR-19b-3p	PAR-CLIP	23592263
MIRT468242	hsa-miR-19a-3p	PAR-CLIP	23592263
MIRT468241	hsa-miR-19b-3p	PAR-CLIP	23592263
MIRT167753	hsa-miR-100-3p	PAR-CLIP	23592263
MIRT468240	hsa-miR-5571-5p	PAR-CLIP	23592263
MIRT468239	hsa-miR-576-3p	PAR-CLIP	23592263
MIRT468238	hsa-miR-648	PAR-CLIP	23592263
MIRT468237	hsa-miR-4302	PAR-CLIP	23592263
MIRT468236	hsa-miR-4738-5p	PAR-CLIP	23592263
MIRT468235	hsa-miR-2115-5p	PAR-CLIP	23592263
MIRT468234	hsa-miR-520a-5p	PAR-CLIP	23592263
MIRT468233	hsa-miR-525-5p	PAR-CLIP	23592263
MIRT468232	hsa-miR-6512-3p	PAR-CLIP	23592263
MIRT468231	hsa-miR-6720-5p	PAR-CLIP	23592263
MIRT468230	hsa-miR-4753-3p	PAR-CLIP	23592263
MIRT468229	hsa-miR-4639-5p	PAR-CLIP	23592263
MIRT468228	hsa-miR-3180-5p	PAR-CLIP	23592263
MIRT468227	hsa-miR-6809-3p	PAR-CLIP	23592263
MIRT468226	hsa-miR-29a-3p	PAR-CLIP	23592263
MIRT468225	hsa-miR-29b-3p	PAR-CLIP	23592263
MIRT468224	hsa-miR-29c-3p	PAR-CLIP	23592263
MIRT468223	hsa-miR-548c-3p	PAR-CLIP	23592263
MIRT468222	hsa-miR-3662	PAR-CLIP	23592263
MIRT468221	hsa-miR-3646	PAR-CLIP	23592263
MIRT468220	hsa-miR-6507-5p	PAR-CLIP	23592263
MIRT468219	hsa-miR-6871-3p	PAR-CLIP	23592263
MIRT468218	hsa-miR-3919	PAR-CLIP	23592263
MIRT468217	hsa-miR-4756-3p	PAR-CLIP	23592263
MIRT468216	hsa-miR-570-3p	PAR-CLIP	23592263
MIRT468215	hsa-miR-1252-5p	PAR-CLIP	23592263
MIRT468214	hsa-miR-4533	PAR-CLIP	23592263
MIRT468213	hsa-miR-3202	PAR-CLIP	23592263
MIRT468212	hsa-miR-5682	PAR-CLIP	23592263
MIRT167795	hsa-miR-6079	PAR-CLIP	23592263
MIRT468211	hsa-miR-3942-3p	PAR-CLIP	23592263
MIRT468210	hsa-miR-365a-3p	PAR-CLIP	23592263
MIRT468209	hsa-miR-365b-3p	PAR-CLIP	23592263
MIRT468208	hsa-miR-5692a	PAR-CLIP	23592263
MIRT468207	hsa-miR-21-3p	PAR-CLIP	23592263
MIRT468206	hsa-miR-3591-3p	PAR-CLIP	23592263
MIRT468205	hsa-miR-4803	PAR-CLIP	23592263
MIRT468204	hsa-miR-552-3p	PAR-CLIP	23592263
MIRT468203	hsa-miR-873-5p	PAR-CLIP	23592263
MIRT468202	hsa-miR-125a-3p	PAR-CLIP	23592263
MIRT468201	hsa-miR-548aj-5p	PAR-CLIP	23592263
MIRT468200	hsa-miR-548f-5p	PAR-CLIP	23592263
MIRT468199	hsa-miR-548g-5p	PAR-CLIP	23592263
MIRT468198	hsa-miR-548x-5p	PAR-CLIP	23592263
MIRT468197	hsa-miR-1468-3p	PAR-CLIP	23592263
MIRT468196	hsa-miR-4641	PAR-CLIP	23592263
MIRT468195	hsa-miR-5095	PAR-CLIP	23592263
MIRT468194	hsa-miR-7151-3p	PAR-CLIP	23592263
MIRT468193	hsa-miR-361-5p	PAR-CLIP	23592263
MIRT468192	hsa-miR-548aw	PAR-CLIP	23592263
MIRT468191	hsa-miR-374a-3p	PAR-CLIP	23592263
MIRT468242	hsa-miR-19a-3p	HITS-CLIP	22473208
MIRT468241	hsa-miR-19b-3p	HITS-CLIP	22473208
MIRT735220	hsa-miR-133b	Luciferase reporter assayqRT-PCRWestern blot	26840046
MIRT735220	hsa-miR-133b	Luciferase reporter assayqRT-PCRWestern blot	26840046
MIRT732886	hsa-miR-424-3p	Luciferase reporter assayMicroarrayqRT-PCR	32432919
MIRT732887	hsa-miR-503-3p	Luciferase reporter assayMicroarrayqRT-PCR	32432919
MIRT735220	hsa-miR-133b	Luciferase reporter assayWestern blottingqRT-PCRFlow cytometry	32597300
MIRT735246	hsa-miR-195-5p	Luciferase reporter assayWestern blottingMicroarrayImmunofluorescenceChIP-seqqRT-PCR	31729781
MIRT468242	hsa-miR-19a-3p	PAR-CLIP	23592263
MIRT468241	hsa-miR-19b-3p	PAR-CLIP	23592263
MIRT468242	hsa-miR-19a-3p	PAR-CLIP	23592263
MIRT468241	hsa-miR-19b-3p	PAR-CLIP	23592263
MIRT167753	hsa-miR-100-3p	PAR-CLIP	23592263
MIRT468240	hsa-miR-5571-5p	PAR-CLIP	23592263
MIRT468239	hsa-miR-576-3p	PAR-CLIP	23592263
MIRT468238	hsa-miR-648	PAR-CLIP	23592263
MIRT468237	hsa-miR-4302	PAR-CLIP	23592263
MIRT468236	hsa-miR-4738-5p	PAR-CLIP	23592263
MIRT468235	hsa-miR-2115-5p	PAR-CLIP	23592263
MIRT468234	hsa-miR-520a-5p	PAR-CLIP	23592263
MIRT468233	hsa-miR-525-5p	PAR-CLIP	23592263
MIRT468232	hsa-miR-6512-3p	PAR-CLIP	23592263
MIRT468231	hsa-miR-6720-5p	PAR-CLIP	23592263
MIRT468230	hsa-miR-4753-3p	PAR-CLIP	23592263
MIRT468229	hsa-miR-4639-5p	PAR-CLIP	23592263
MIRT468228	hsa-miR-3180-5p	PAR-CLIP	23592263
MIRT468227	hsa-miR-6809-3p	PAR-CLIP	23592263
MIRT468226	hsa-miR-29a-3p	PAR-CLIP	23592263
MIRT468225	hsa-miR-29b-3p	PAR-CLIP	23592263
MIRT468224	hsa-miR-29c-3p	PAR-CLIP	23592263
MIRT468223	hsa-miR-548c-3p	PAR-CLIP	23592263
MIRT468222	hsa-miR-3662	PAR-CLIP	23592263
MIRT468221	hsa-miR-3646	PAR-CLIP	23592263
MIRT468220	hsa-miR-6507-5p	PAR-CLIP	23592263
MIRT468219	hsa-miR-6871-3p	PAR-CLIP	23592263
MIRT468218	hsa-miR-3919	PAR-CLIP	23592263
MIRT468217	hsa-miR-4756-3p	PAR-CLIP	23592263
MIRT468216	hsa-miR-570-3p	PAR-CLIP	23592263
MIRT468215	hsa-miR-1252-5p	PAR-CLIP	23592263
MIRT468214	hsa-miR-4533	PAR-CLIP	23592263
MIRT468213	hsa-miR-3202	PAR-CLIP	23592263
MIRT468212	hsa-miR-5682	PAR-CLIP	23592263
MIRT167795	hsa-miR-6079	PAR-CLIP	23592263
MIRT468211	hsa-miR-3942-3p	PAR-CLIP	23592263
MIRT468210	hsa-miR-365a-3p	PAR-CLIP	23592263
MIRT468209	hsa-miR-365b-3p	PAR-CLIP	23592263
MIRT468208	hsa-miR-5692a	PAR-CLIP	23592263
MIRT468207	hsa-miR-21-3p	PAR-CLIP	23592263
MIRT468206	hsa-miR-3591-3p	PAR-CLIP	23592263
MIRT468205	hsa-miR-4803	PAR-CLIP	23592263
MIRT468204	hsa-miR-552-3p	PAR-CLIP	23592263
MIRT468203	hsa-miR-873-5p	PAR-CLIP	23592263
MIRT468202	hsa-miR-125a-3p	PAR-CLIP	23592263
MIRT468201	hsa-miR-548aj-5p	PAR-CLIP	23592263
MIRT468200	hsa-miR-548f-5p	PAR-CLIP	23592263
MIRT468199	hsa-miR-548g-5p	PAR-CLIP	23592263
MIRT468198	hsa-miR-548x-5p	PAR-CLIP	23592263
MIRT468197	hsa-miR-1468-3p	PAR-CLIP	23592263
MIRT468196	hsa-miR-4641	PAR-CLIP	23592263
MIRT468195	hsa-miR-5095	PAR-CLIP	23592263
MIRT468194	hsa-miR-7151-3p	PAR-CLIP	23592263
MIRT468193	hsa-miR-361-5p	PAR-CLIP	23592263
MIRT468192	hsa-miR-548aw	PAR-CLIP	23592263
MIRT468191	hsa-miR-374a-3p	PAR-CLIP	23592263
MIRT1343074	hsa-miR-140-3p	CLIP-seq
MIRT1343075	hsa-miR-342-3p	CLIP-seq
MIRT1343076	hsa-miR-377	CLIP-seq
MIRT1343077	hsa-miR-4317	CLIP-seq
MIRT1343078	hsa-miR-4696	CLIP-seq
MIRT1343079	hsa-miR-513a-3p	CLIP-seq
MIRT1343080	hsa-miR-590-3p	CLIP-seq
MIRT1343081	hsa-miR-616	CLIP-seq
MIRT1343082	hsa-miR-1207-3p	CLIP-seq
MIRT1343083	hsa-miR-1255a	CLIP-seq
MIRT1343084	hsa-miR-1255b	CLIP-seq
MIRT1343085	hsa-miR-1256	CLIP-seq
MIRT1343086	hsa-miR-133a	CLIP-seq
MIRT1343087	hsa-miR-147	CLIP-seq
MIRT1343088	hsa-miR-15a	CLIP-seq
MIRT1343089	hsa-miR-15b	CLIP-seq
MIRT1343090	hsa-miR-16	CLIP-seq
MIRT1343091	hsa-miR-195	CLIP-seq
MIRT1343092	hsa-miR-2964a-5p	CLIP-seq
MIRT1343093	hsa-miR-3121-3p	CLIP-seq
MIRT1343094	hsa-miR-3126-5p	CLIP-seq
MIRT1343095	hsa-miR-3160-5p	CLIP-seq
MIRT1343096	hsa-miR-3613-3p	CLIP-seq
MIRT1343097	hsa-miR-3674	CLIP-seq
MIRT1343076	hsa-miR-377	CLIP-seq
MIRT1343098	hsa-miR-382	CLIP-seq
MIRT1343099	hsa-miR-3908	CLIP-seq
MIRT1343100	hsa-miR-424	CLIP-seq
MIRT1343101	hsa-miR-4263	CLIP-seq
MIRT1343102	hsa-miR-4419a	CLIP-seq
MIRT1343103	hsa-miR-4421	CLIP-seq
MIRT1343104	hsa-miR-4426	CLIP-seq
MIRT1343105	hsa-miR-4427	CLIP-seq
MIRT1343106	hsa-miR-4503	CLIP-seq
MIRT1343107	hsa-miR-4510	CLIP-seq
MIRT1343108	hsa-miR-4524	CLIP-seq
MIRT1343109	hsa-miR-4647	CLIP-seq
MIRT1343110	hsa-miR-4662b	CLIP-seq
MIRT1343111	hsa-miR-4680-3p	CLIP-seq
MIRT1343112	hsa-miR-4747-5p	CLIP-seq
MIRT1343113	hsa-miR-4799-5p	CLIP-seq
MIRT1343114	hsa-miR-486-3p	CLIP-seq
MIRT1343115	hsa-miR-497	CLIP-seq
MIRT1343116	hsa-miR-503	CLIP-seq
MIRT1343117	hsa-miR-508-3p	CLIP-seq
MIRT1343118	hsa-miR-548ac	CLIP-seq
MIRT1343119	hsa-miR-548ae	CLIP-seq
MIRT1343120	hsa-miR-548aj	CLIP-seq
MIRT1343121	hsa-miR-548am	CLIP-seq
MIRT1343122	hsa-miR-548d-3p	CLIP-seq
MIRT1343123	hsa-miR-548x	CLIP-seq
MIRT1343124	hsa-miR-548z	CLIP-seq
MIRT1343125	hsa-miR-549	CLIP-seq
MIRT1343126	hsa-miR-576-5p	CLIP-seq
MIRT1343127	hsa-miR-643	CLIP-seq
MIRT1343128	hsa-miR-646	CLIP-seq
MIRT1343082	hsa-miR-1207-3p	CLIP-seq
MIRT1343085	hsa-miR-1256	CLIP-seq
MIRT1343086	hsa-miR-133a	CLIP-seq
MIRT1343088	hsa-miR-15a	CLIP-seq
MIRT1343089	hsa-miR-15b	CLIP-seq
MIRT1343090	hsa-miR-16	CLIP-seq
MIRT1343091	hsa-miR-195	CLIP-seq
MIRT2101404	hsa-miR-19a	CLIP-seq
MIRT2101405	hsa-miR-19b	CLIP-seq
MIRT1343092	hsa-miR-2964a-5p	CLIP-seq
MIRT1343095	hsa-miR-3160-5p	CLIP-seq
MIRT1343097	hsa-miR-3674	CLIP-seq
MIRT1343099	hsa-miR-3908	CLIP-seq
MIRT1343100	hsa-miR-424	CLIP-seq
MIRT1343103	hsa-miR-4421	CLIP-seq
MIRT1343104	hsa-miR-4426	CLIP-seq
MIRT1343105	hsa-miR-4427	CLIP-seq
MIRT2101406	hsa-miR-4467	CLIP-seq
MIRT1343106	hsa-miR-4503	CLIP-seq
MIRT1343108	hsa-miR-4524	CLIP-seq
MIRT1343109	hsa-miR-4647	CLIP-seq
MIRT1343110	hsa-miR-4662b	CLIP-seq
MIRT1343111	hsa-miR-4680-3p	CLIP-seq
MIRT1343114	hsa-miR-486-3p	CLIP-seq
MIRT1343115	hsa-miR-497	CLIP-seq
MIRT1343116	hsa-miR-503	CLIP-seq
MIRT1343118	hsa-miR-548ac	CLIP-seq
MIRT1343119	hsa-miR-548ae	CLIP-seq
MIRT1343120	hsa-miR-548aj	CLIP-seq
MIRT1343121	hsa-miR-548am	CLIP-seq
MIRT1343122	hsa-miR-548d-3p	CLIP-seq
MIRT1343123	hsa-miR-548x	CLIP-seq
MIRT1343124	hsa-miR-548z	CLIP-seq
MIRT1343125	hsa-miR-549	CLIP-seq
MIRT2101407	hsa-miR-552	CLIP-seq
MIRT2101408	hsa-miR-556-5p	CLIP-seq
MIRT1343127	hsa-miR-643	CLIP-seq
MIRT1343128	hsa-miR-646	CLIP-seq
MIRT2325776	hsa-miR-186	CLIP-seq
MIRT2325777	hsa-miR-3133	CLIP-seq
MIRT2325778	hsa-miR-4511	CLIP-seq
MIRT1343074	hsa-miR-140-3p	CLIP-seq
MIRT2101404	hsa-miR-19a	CLIP-seq
MIRT2101405	hsa-miR-19b	CLIP-seq
MIRT1343075	hsa-miR-342-3p	CLIP-seq
MIRT1343096	hsa-miR-3613-3p	CLIP-seq
MIRT1343076	hsa-miR-377	CLIP-seq
MIRT2433078	hsa-miR-101	CLIP-seq
MIRT2433079	hsa-miR-1236	CLIP-seq
MIRT2433080	hsa-miR-124	CLIP-seq
MIRT1343085	hsa-miR-1256	CLIP-seq
MIRT2433081	hsa-miR-1273d	CLIP-seq
MIRT1343086	hsa-miR-133a	CLIP-seq
MIRT1343074	hsa-miR-140-3p	CLIP-seq
MIRT2433082	hsa-miR-144	CLIP-seq
MIRT2325776	hsa-miR-186	CLIP-seq
MIRT2433083	hsa-miR-2053	CLIP-seq
MIRT2433084	hsa-miR-216b	CLIP-seq
MIRT2433085	hsa-miR-23a	CLIP-seq
MIRT2433086	hsa-miR-23b	CLIP-seq
MIRT2433087	hsa-miR-23c	CLIP-seq
MIRT2433088	hsa-miR-299-5p	CLIP-seq
MIRT2433089	hsa-miR-300	CLIP-seq
MIRT2325777	hsa-miR-3133	CLIP-seq
MIRT2433090	hsa-miR-323-3p	CLIP-seq
MIRT2433091	hsa-miR-323-5p	CLIP-seq
MIRT2433092	hsa-miR-338-5p	CLIP-seq
MIRT1343096	hsa-miR-3613-3p	CLIP-seq
MIRT2433093	hsa-miR-3618	CLIP-seq
MIRT2433094	hsa-miR-3688-3p	CLIP-seq
MIRT1343076	hsa-miR-377	CLIP-seq
MIRT2433095	hsa-miR-381	CLIP-seq
MIRT2433096	hsa-miR-383	CLIP-seq
MIRT2433097	hsa-miR-3923	CLIP-seq
MIRT2433098	hsa-miR-4255	CLIP-seq
MIRT2433099	hsa-miR-4269	CLIP-seq
MIRT2433100	hsa-miR-4457	CLIP-seq
MIRT2433101	hsa-miR-4477a	CLIP-seq
MIRT2433102	hsa-miR-451	CLIP-seq
MIRT2433103	hsa-miR-4514	CLIP-seq
MIRT2433104	hsa-miR-4643	CLIP-seq
MIRT2433105	hsa-miR-466	CLIP-seq
MIRT2433106	hsa-miR-4666-3p	CLIP-seq
MIRT2433107	hsa-miR-4668-3p	CLIP-seq
MIRT2433108	hsa-miR-4668-5p	CLIP-seq
MIRT2433109	hsa-miR-4677-3p	CLIP-seq
MIRT2433110	hsa-miR-4679	CLIP-seq
MIRT2433111	hsa-miR-4692	CLIP-seq
MIRT2433112	hsa-miR-4716-5p	CLIP-seq
MIRT2433113	hsa-miR-4742-5p	CLIP-seq
MIRT2433114	hsa-miR-4772-5p	CLIP-seq
MIRT2433115	hsa-miR-4789-3p	CLIP-seq
MIRT2433116	hsa-miR-4789-5p	CLIP-seq
MIRT1343114	hsa-miR-486-3p	CLIP-seq
MIRT2433117	hsa-miR-494	CLIP-seq
MIRT2433118	hsa-miR-495	CLIP-seq
MIRT2433119	hsa-miR-506	CLIP-seq
MIRT1343117	hsa-miR-508-3p	CLIP-seq
MIRT2433120	hsa-miR-520d-5p	CLIP-seq
MIRT2433121	hsa-miR-522	CLIP-seq
MIRT2433122	hsa-miR-524-5p	CLIP-seq
MIRT1343118	hsa-miR-548ac	CLIP-seq
MIRT1343119	hsa-miR-548ae	CLIP-seq
MIRT1343120	hsa-miR-548aj	CLIP-seq
MIRT1343121	hsa-miR-548am	CLIP-seq
MIRT2433123	hsa-miR-548an	CLIP-seq
MIRT1343122	hsa-miR-548d-3p	CLIP-seq
MIRT1343123	hsa-miR-548x	CLIP-seq
MIRT1343124	hsa-miR-548z	CLIP-seq
MIRT1343125	hsa-miR-549	CLIP-seq
MIRT2433124	hsa-miR-569	CLIP-seq
MIRT2433125	hsa-miR-582-5p	CLIP-seq
MIRT2433126	hsa-miR-600	CLIP-seq
MIRT2433127	hsa-miR-873	CLIP-seq
MIRT2433128	hsa-miR-876-3p	CLIP-seq
MIRT2433106	hsa-miR-4666-3p	CLIP-seq
MIRT2440262	hsa-miR-1184	CLIP-seq
MIRT2440263	hsa-miR-1205	CLIP-seq
MIRT2433079	hsa-miR-1236	CLIP-seq
MIRT2433080	hsa-miR-124	CLIP-seq
MIRT2440264	hsa-miR-1252	CLIP-seq
MIRT1343085	hsa-miR-1256	CLIP-seq
MIRT2440265	hsa-miR-1286	CLIP-seq
MIRT2440266	hsa-miR-1324	CLIP-seq
MIRT1343086	hsa-miR-133a	CLIP-seq
MIRT2440267	hsa-miR-141	CLIP-seq
MIRT1343088	hsa-miR-15a	CLIP-seq
MIRT1343089	hsa-miR-15b	CLIP-seq
MIRT1343090	hsa-miR-16	CLIP-seq
MIRT2325776	hsa-miR-186	CLIP-seq
MIRT1343091	hsa-miR-195	CLIP-seq
MIRT2440268	hsa-miR-1976	CLIP-seq
MIRT2440269	hsa-miR-200a	CLIP-seq
MIRT2433084	hsa-miR-216b	CLIP-seq
MIRT2440270	hsa-miR-29a	CLIP-seq
MIRT2440271	hsa-miR-29b	CLIP-seq
MIRT2440272	hsa-miR-29c	CLIP-seq
MIRT1343093	hsa-miR-3121-3p	CLIP-seq
MIRT2325777	hsa-miR-3133	CLIP-seq
MIRT2440273	hsa-miR-3158-5p	CLIP-seq
MIRT1343095	hsa-miR-3160-5p	CLIP-seq
MIRT1343097	hsa-miR-3674	CLIP-seq
MIRT1343076	hsa-miR-377	CLIP-seq
MIRT1343099	hsa-miR-3908	CLIP-seq
MIRT1343100	hsa-miR-424	CLIP-seq
MIRT1343101	hsa-miR-4263	CLIP-seq
MIRT2440274	hsa-miR-4315	CLIP-seq
MIRT1343105	hsa-miR-4427	CLIP-seq
MIRT2433100	hsa-miR-4457	CLIP-seq
MIRT2440275	hsa-miR-4496	CLIP-seq
MIRT1343106	hsa-miR-4503	CLIP-seq
MIRT2325778	hsa-miR-4511	CLIP-seq
MIRT2440276	hsa-miR-4521	CLIP-seq
MIRT1343108	hsa-miR-4524	CLIP-seq
MIRT2440277	hsa-miR-4633-3p	CLIP-seq
MIRT2433108	hsa-miR-4668-5p	CLIP-seq
MIRT1343111	hsa-miR-4680-3p	CLIP-seq
MIRT2440278	hsa-miR-4690-3p	CLIP-seq
MIRT2440279	hsa-miR-4722-3p	CLIP-seq
MIRT2440280	hsa-miR-4722-5p	CLIP-seq
MIRT2440281	hsa-miR-4768-3p	CLIP-seq
MIRT2440282	hsa-miR-4773	CLIP-seq
MIRT1343113	hsa-miR-4799-5p	CLIP-seq
MIRT1343114	hsa-miR-486-3p	CLIP-seq
MIRT2433117	hsa-miR-494	CLIP-seq
MIRT1343115	hsa-miR-497	CLIP-seq
MIRT1343116	hsa-miR-503	CLIP-seq
MIRT2433119	hsa-miR-506	CLIP-seq
MIRT2440283	hsa-miR-524-3p	CLIP-seq
MIRT2440284	hsa-miR-525-3p	CLIP-seq
MIRT1343118	hsa-miR-548ac	CLIP-seq
MIRT1343119	hsa-miR-548ae	CLIP-seq
MIRT1343120	hsa-miR-548aj	CLIP-seq
MIRT1343121	hsa-miR-548am	CLIP-seq
MIRT2433123	hsa-miR-548an	CLIP-seq
MIRT1343122	hsa-miR-548d-3p	CLIP-seq
MIRT1343123	hsa-miR-548x	CLIP-seq
MIRT1343124	hsa-miR-548z	CLIP-seq
MIRT1343125	hsa-miR-549	CLIP-seq
MIRT1343126	hsa-miR-576-5p	CLIP-seq
MIRT2440285	hsa-miR-610	CLIP-seq
MIRT1343128	hsa-miR-646	CLIP-seq
MIRT2440286	hsa-miR-769-5p	CLIP-seq
MIRT2440262	hsa-miR-1184	CLIP-seq
MIRT2440263	hsa-miR-1205	CLIP-seq
MIRT2433079	hsa-miR-1236	CLIP-seq
MIRT2433080	hsa-miR-124	CLIP-seq
MIRT2440265	hsa-miR-1286	CLIP-seq
MIRT2440266	hsa-miR-1324	CLIP-seq
MIRT2440268	hsa-miR-1976	CLIP-seq
MIRT2433084	hsa-miR-216b	CLIP-seq
MIRT2440273	hsa-miR-3158-5p	CLIP-seq
MIRT1343095	hsa-miR-3160-5p	CLIP-seq
MIRT1343076	hsa-miR-377	CLIP-seq
MIRT1343101	hsa-miR-4263	CLIP-seq
MIRT2440274	hsa-miR-4315	CLIP-seq
MIRT2440276	hsa-miR-4521	CLIP-seq
MIRT2440279	hsa-miR-4722-3p	CLIP-seq
MIRT2440280	hsa-miR-4722-5p	CLIP-seq
MIRT2440281	hsa-miR-4768-3p	CLIP-seq
MIRT2440282	hsa-miR-4773	CLIP-seq
MIRT2433119	hsa-miR-506	CLIP-seq
MIRT2440283	hsa-miR-524-3p	CLIP-seq
MIRT2440284	hsa-miR-525-3p	CLIP-seq
MIRT2433123	hsa-miR-548an	CLIP-seq
MIRT1343126	hsa-miR-576-5p	CLIP-seq
MIRT2440286	hsa-miR-769-5p	CLIP-seq
MIRT2440262	hsa-miR-1184	CLIP-seq
MIRT2440263	hsa-miR-1205	CLIP-seq
MIRT2433079	hsa-miR-1236	CLIP-seq
MIRT2433080	hsa-miR-124	CLIP-seq
MIRT1343085	hsa-miR-1256	CLIP-seq
MIRT2440265	hsa-miR-1286	CLIP-seq
MIRT2440266	hsa-miR-1324	CLIP-seq
MIRT1343086	hsa-miR-133a	CLIP-seq
MIRT2440267	hsa-miR-141	CLIP-seq
MIRT1343088	hsa-miR-15a	CLIP-seq
MIRT1343089	hsa-miR-15b	CLIP-seq
MIRT1343090	hsa-miR-16	CLIP-seq
MIRT2325776	hsa-miR-186	CLIP-seq
MIRT1343091	hsa-miR-195	CLIP-seq
MIRT2440268	hsa-miR-1976	CLIP-seq
MIRT2440269	hsa-miR-200a	CLIP-seq
MIRT2433084	hsa-miR-216b	CLIP-seq
MIRT1343093	hsa-miR-3121-3p	CLIP-seq
MIRT2325777	hsa-miR-3133	CLIP-seq
MIRT2440273	hsa-miR-3158-5p	CLIP-seq
MIRT1343095	hsa-miR-3160-5p	CLIP-seq
MIRT1343097	hsa-miR-3674	CLIP-seq
MIRT1343076	hsa-miR-377	CLIP-seq
MIRT1343099	hsa-miR-3908	CLIP-seq
MIRT1343100	hsa-miR-424	CLIP-seq
MIRT1343101	hsa-miR-4263	CLIP-seq
MIRT2440274	hsa-miR-4315	CLIP-seq
MIRT1343077	hsa-miR-4317	CLIP-seq
MIRT1343105	hsa-miR-4427	CLIP-seq
MIRT2433100	hsa-miR-4457	CLIP-seq
MIRT2433101	hsa-miR-4477a	CLIP-seq
MIRT2440275	hsa-miR-4496	CLIP-seq
MIRT1343106	hsa-miR-4503	CLIP-seq
MIRT2433102	hsa-miR-451	CLIP-seq
MIRT2325778	hsa-miR-4511	CLIP-seq
MIRT2440276	hsa-miR-4521	CLIP-seq
MIRT1343108	hsa-miR-4524	CLIP-seq
MIRT2440277	hsa-miR-4633-3p	CLIP-seq
MIRT2433108	hsa-miR-4668-5p	CLIP-seq
MIRT1343111	hsa-miR-4680-3p	CLIP-seq
MIRT2440278	hsa-miR-4690-3p	CLIP-seq
MIRT1343078	hsa-miR-4696	CLIP-seq
MIRT2440279	hsa-miR-4722-3p	CLIP-seq
MIRT2440280	hsa-miR-4722-5p	CLIP-seq
MIRT2440281	hsa-miR-4768-3p	CLIP-seq
MIRT2440282	hsa-miR-4773	CLIP-seq
MIRT1343113	hsa-miR-4799-5p	CLIP-seq
MIRT1343114	hsa-miR-486-3p	CLIP-seq
MIRT2433117	hsa-miR-494	CLIP-seq
MIRT1343115	hsa-miR-497	CLIP-seq
MIRT1343116	hsa-miR-503	CLIP-seq
MIRT2433119	hsa-miR-506	CLIP-seq
MIRT1343079	hsa-miR-513a-3p	CLIP-seq
MIRT2440283	hsa-miR-524-3p	CLIP-seq
MIRT2440284	hsa-miR-525-3p	CLIP-seq
MIRT1343118	hsa-miR-548ac	CLIP-seq
MIRT1343119	hsa-miR-548ae	CLIP-seq
MIRT1343120	hsa-miR-548aj	CLIP-seq
MIRT1343121	hsa-miR-548am	CLIP-seq
MIRT2433123	hsa-miR-548an	CLIP-seq
MIRT1343122	hsa-miR-548d-3p	CLIP-seq
MIRT1343123	hsa-miR-548x	CLIP-seq
MIRT1343124	hsa-miR-548z	CLIP-seq
MIRT1343125	hsa-miR-549	CLIP-seq
MIRT1343126	hsa-miR-576-5p	CLIP-seq
MIRT1343080	hsa-miR-590-3p	CLIP-seq
MIRT2440285	hsa-miR-610	CLIP-seq
MIRT1343081	hsa-miR-616	CLIP-seq
MIRT1343128	hsa-miR-646	CLIP-seq
MIRT2440286	hsa-miR-769-5p	CLIP-seq
MIRT1343095	hsa-miR-3160-5p	CLIP-seq
MIRT1343101	hsa-miR-4263	CLIP-seq
MIRT2433117	hsa-miR-494	CLIP-seq
MIRT1343126	hsa-miR-576-5p	CLIP-seq
MIRT1343095	hsa-miR-3160-5p	CLIP-seq
MIRT1343101	hsa-miR-4263	CLIP-seq
MIRT2433117	hsa-miR-494	CLIP-seq
MIRT1343126	hsa-miR-576-5p	CLIP-seq
MIRT2440262	hsa-miR-1184	CLIP-seq
MIRT2440263	hsa-miR-1205	CLIP-seq
MIRT2433079	hsa-miR-1236	CLIP-seq
MIRT2433080	hsa-miR-124	CLIP-seq
MIRT2440264	hsa-miR-1252	CLIP-seq
MIRT1343085	hsa-miR-1256	CLIP-seq
MIRT2440265	hsa-miR-1286	CLIP-seq
MIRT2440266	hsa-miR-1324	CLIP-seq
MIRT1343086	hsa-miR-133a	CLIP-seq
MIRT2440267	hsa-miR-141	CLIP-seq
MIRT1343088	hsa-miR-15a	CLIP-seq
MIRT1343089	hsa-miR-15b	CLIP-seq
MIRT1343090	hsa-miR-16	CLIP-seq
MIRT2325776	hsa-miR-186	CLIP-seq
MIRT1343091	hsa-miR-195	CLIP-seq
MIRT2440268	hsa-miR-1976	CLIP-seq
MIRT2440269	hsa-miR-200a	CLIP-seq
MIRT2690583	hsa-miR-2115	CLIP-seq
MIRT2433084	hsa-miR-216b	CLIP-seq
MIRT2440270	hsa-miR-29a	CLIP-seq
MIRT2440271	hsa-miR-29b	CLIP-seq
MIRT2440272	hsa-miR-29c	CLIP-seq
MIRT1343093	hsa-miR-3121-3p	CLIP-seq
MIRT2325777	hsa-miR-3133	CLIP-seq
MIRT2440273	hsa-miR-3158-5p	CLIP-seq
MIRT1343095	hsa-miR-3160-5p	CLIP-seq
MIRT1343096	hsa-miR-3613-3p	CLIP-seq
MIRT1343097	hsa-miR-3674	CLIP-seq
MIRT1343076	hsa-miR-377	CLIP-seq
MIRT1343099	hsa-miR-3908	CLIP-seq
MIRT1343100	hsa-miR-424	CLIP-seq
MIRT1343101	hsa-miR-4263	CLIP-seq
MIRT2440274	hsa-miR-4315	CLIP-seq
MIRT1343077	hsa-miR-4317	CLIP-seq
MIRT1343105	hsa-miR-4427	CLIP-seq
MIRT2433100	hsa-miR-4457	CLIP-seq
MIRT2433101	hsa-miR-4477a	CLIP-seq
MIRT2440275	hsa-miR-4496	CLIP-seq
MIRT1343106	hsa-miR-4503	CLIP-seq
MIRT2433102	hsa-miR-451	CLIP-seq
MIRT2325778	hsa-miR-4511	CLIP-seq
MIRT2440276	hsa-miR-4521	CLIP-seq
MIRT1343108	hsa-miR-4524	CLIP-seq
MIRT2440277	hsa-miR-4633-3p	CLIP-seq
MIRT2433108	hsa-miR-4668-5p	CLIP-seq
MIRT1343111	hsa-miR-4680-3p	CLIP-seq
MIRT2440278	hsa-miR-4690-3p	CLIP-seq
MIRT1343078	hsa-miR-4696	CLIP-seq
MIRT2440279	hsa-miR-4722-3p	CLIP-seq
MIRT2440280	hsa-miR-4722-5p	CLIP-seq
MIRT2440281	hsa-miR-4768-3p	CLIP-seq
MIRT2440282	hsa-miR-4773	CLIP-seq
MIRT1343113	hsa-miR-4799-5p	CLIP-seq
MIRT1343114	hsa-miR-486-3p	CLIP-seq
MIRT2433117	hsa-miR-494	CLIP-seq
MIRT1343115	hsa-miR-497	CLIP-seq
MIRT1343116	hsa-miR-503	CLIP-seq
MIRT2433119	hsa-miR-506	CLIP-seq
MIRT1343079	hsa-miR-513a-3p	CLIP-seq
MIRT2440283	hsa-miR-524-3p	CLIP-seq
MIRT2440284	hsa-miR-525-3p	CLIP-seq
MIRT1343118	hsa-miR-548ac	CLIP-seq
MIRT1343119	hsa-miR-548ae	CLIP-seq
MIRT1343120	hsa-miR-548aj	CLIP-seq
MIRT1343121	hsa-miR-548am	CLIP-seq
MIRT2433123	hsa-miR-548an	CLIP-seq
MIRT1343122	hsa-miR-548d-3p	CLIP-seq
MIRT1343123	hsa-miR-548x	CLIP-seq
MIRT1343124	hsa-miR-548z	CLIP-seq
MIRT1343125	hsa-miR-549	CLIP-seq
MIRT2690584	hsa-miR-570	CLIP-seq
MIRT1343126	hsa-miR-576-5p	CLIP-seq
MIRT1343080	hsa-miR-590-3p	CLIP-seq
MIRT2440285	hsa-miR-610	CLIP-seq
MIRT1343081	hsa-miR-616	CLIP-seq
MIRT1343128	hsa-miR-646	CLIP-seq
MIRT2440286	hsa-miR-769-5p	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
APC	Repression	18487207

Show/Hide all (51)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001558	Process	Regulation of cell growth	IEA
GO:0001558	Process	Regulation of cell growth	TAS	20919962
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	TAS	9114008
GO:0004712	Function	Protein serine/threonine/tyrosine kinase activity	IDA	22797923
GO:0005246	Function	Calcium channel regulator activity	TAS	20530112
GO:0005515	Function	Protein binding	IPI	17360471, 20237237, 27451907, 28514442, 32296183, 33961781
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IEA
GO:0006468	Process	Protein phosphorylation	TAS	9114008
GO:0006814	Process	Sodium ion transport	TAS	10884438
GO:0006915	Process	Apoptotic process	IEA
GO:0006974	Process	DNA damage response	IEA
GO:0007616	Process	Long-term memory	TAS	20530112
GO:0008217	Process	Regulation of blood pressure	TAS	16460280
GO:0015459	Function	Potassium channel regulator activity	IBA
GO:0015459	Function	Potassium channel regulator activity	TAS	20530112
GO:0016020	Component	Membrane	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016607	Component	Nuclear speck	IDA
GO:0016740	Function	Transferase activity	IEA
GO:0017080	Function	Sodium channel regulator activity	IEA
GO:0017080	Function	Sodium channel regulator activity	TAS	20530112
GO:0017081	Function	Chloride channel regulator activity	TAS	20530112
GO:0030334	Process	Regulation of cell migration	TAS	20919962
GO:0032411	Process	Positive regulation of transporter activity	TAS	20530112
GO:0035556	Process	Intracellular signal transduction	IBA
GO:0042127	Process	Regulation of cell population proliferation	IEA
GO:0042127	Process	Regulation of cell population proliferation	TAS	20530112
GO:0042981	Process	Regulation of apoptotic process	TAS	20530112
GO:0048812	Process	Neuron projection morphogenesis	IBA
GO:0050790	Process	Regulation of catalytic activity	TAS	20530112
GO:0051090	Process	Regulation of DNA-binding transcription factor activity	TAS	20530112
GO:0060453	Process	Regulation of gastric acid secretion	TAS	20530112
GO:0070294	Process	Renal sodium ion absorption	TAS	16460280
GO:0106310	Function	Protein serine kinase activity	IEA
GO:1901796	Process	Regulation of signal transduction by p53 class mediator	TAS
GO:1904045	Process	Cellular response to aldosterone	IEA

MIM	HGNC	e!Ensembl
602958	10810	ENSG00000118515

O00141

Protein name

Serine/threonine-protein kinase Sgk1 (EC 2.7.11.1) (Serum/glucocorticoid-regulated kinase 1)

Protein function

Serine/threonine-protein kinase which is involved in the regulation of a wide variety of ion channels, membrane transporters, cellular enzymes, transcription factors, neuronal excitability, cell growth, proliferation, survival, migration and apo

PDB

2R5T , 3HDM , 3HDN , 7PUE

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	98 → 355	Protein kinase domain	Domain
PF00433	Pkinase_C	376 → 423	Protein kinase C terminal domain	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in most tissues with highest levels in the pancreas, followed by placenta, kidney and lung. Isoform 2 is strongly expressed in brain and pancreas, weaker in heart, placenta, lung, liver and skeletal muscle. {ECO:0000269|PubMe

Sequence

MTVKTEAAKGTLTYSRMRGMVAILIAFMKQRRMGLNDFIQKIANNSYACKHPEVQSILKI
SQPQEPELMNANPSPPPSPSQQINLGPSSNPHAKPSDFHFLKVIGKGSFGKVLLARHKAE
EVFYAVKVLQKKAILKKKEEKHIMSERNVLLKNVKHPFLVGLHFSFQTADKLYFVLDYIN
GGELFYHLQRERCFLEPRARFYAAEIASALGYLHSLNIVYRDLKPENILLDSQGHIVLTD
FGLCKENIEHNSTTSTFCGTPEYLAPEVLHKQPYDRTVDWWCLGAVLYEMLYGLPPFYSR
NTAEMYDNILNKPLQLKPNITNSARHLLEGLLQKDRTKRLGAKDDFMEIKSHVFFSLINW
DDLINKKITPPFNPNVSGPNDLRHFDPEFTEEPVPNSIGKSPDSVLVTASVKEAAEAFLG
FSYAPPTDSFL

Sequence length

431

Interactions

View interactions

	KEGG		Reactome
	FoxO signaling pathway Efferocytosis mTOR signaling pathway PI3K-Akt signaling pathway Parathyroid hormone synthesis, secretion and action Aldosterone-regulated sodium reabsorption		Stimuli-sensing channels Regulation of TP53 Degradation NGF-stimulated transcription

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Multiple myeloma	Likely pathogenic	rs1171390403	RCV000984130	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (17)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ECZEMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN INFARCTION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBRAL AMYLOID ANGIOPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEUROPATHIES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA, MYELOID, ACUTE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEWY BODY DEMENTIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PELVIC ORGAN PROLAPSE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNIPOLAR DEPRESSION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UREMIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (183)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute Myeloid Leukemia (AML-M2)	Leukemia	CTD_human_DG	17330099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Myeloid Leukemia, M1	Myeloid Leukemia	CTD_human_DG	17330099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	30257988		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	20541034, 22496620, 23055545		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	18487207, 20110688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	22496620, 23055545	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenocortical carcinoma	Adrenocortical carcinoma	BEFREE	23055545		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	24685888		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	GWASCAT_DG	26830138		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	16125969		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic carcinoma	Anaplastic Carcinoma	CTD_human_DG	16316942		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety disorder	Pubtator	29249830	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	36611927	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asymmetric Diabetic Proximal Motor Neuropathy	Asymmetric Diabetic Proximal Motor Neuropathy	CTD_human_DG	16696316		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	23467085, 28787716, 29346764		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	30694908		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	15981206		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Cerebral Ischemia	BEFREE	29260627		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	15679045, 23581296, 26419593, 30866857, 31694887		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	22842983, 30337371, 33783250, 37854018	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Calcinosis	Calcinosis	Pubtator	33003561, 35339998	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	22496620	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	15981206		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma	Carcinoma	CTD_human_DG	16316942		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	12521301, 39273406	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	22240294	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	19383827		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Spindle-Cell	Carcinoma	CTD_human_DG	16316942		★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	19966577		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	23933686, 29260627		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	31136958		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	31136958		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	24685888		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	15917303	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	15304560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	GWASDB_DG	21931561		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	29889103		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	31203134		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic rhinosinusitis with nasal polyps	Rhinosinusitis With Nasal Polyps	BEFREE	30081034		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	26034353		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	20541034		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	21079778	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	21079778, 28819428, 29170478, 30272280, 30322876, 30439718		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	21079778, 28902367, 33783250	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	21079778	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital long QT syndrome	Congenital Long QT Syndrome	BEFREE	28336914		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	23019294, 29243066		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	17982254		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	26034353		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	11509829		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	31330080		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	31153932, 31281445, 31725056		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	39245941	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	10589686, 16301823, 18653620, 19584721, 19764891, 30551357		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	10589686, 16105029, 16301823, 18653620, 19584721, 19764891, 30551357		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	18985156	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	16105029, 18209482, 18985156, 19764891, 23933686, 31841202		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Amyotrophy	Diabetic Amyotrophy	CTD_human_DG	16696316		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Angiopathies	Diabetic cardiomyopathy	BEFREE	24961472		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Asymmetric Polyneuropathy	Diabetic Asymmetric Polyneuropathy	CTD_human_DG	16696316		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Autonomic Neuropathy	Diabetic Autonomic Neuropathy	CTD_human_DG	16696316		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Cardiomyopathies	Diabetic cardiomyopathy	BEFREE	31729781		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Mononeuropathy	Diabetic Mononeuropathy	CTD_human_DG	16696316		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	37079269	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	10589686, 16301823, 18653620, 19764891, 31497211, 31841202		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	LHGDN	16301823		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Neuralgia	Diabetic Neuralgia	CTD_human_DG	16696316		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Neuropathies	Diabetic Nephropathy	CTD_human_DG	16696316		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Polyneuropathies	Diabetic polyneuropathy	CTD_human_DG	16696316		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diarrhea 5 With Tufting Enteropathy Congenital	Congenital diarrhea	Pubtator	31641423	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	26658840		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	CGI_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	28177128		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	26827666	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	20933037		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelioma	Epithelioma	BEFREE	17571248, 27771704		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	32106831	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	12215463		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	31600722		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	28848088, 28993509, 29930759, 29976632		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	28848088, 28993509, 29976632, 33783250	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	28848088, 28993509, 29930759, 29976632, 31101126, 31414267		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	26908461, 27560795, 31734653	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	28993509		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	22554965	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	23019294, 29243066		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	30213827	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	LHGDN	14725621		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	16301823, 19764891, 23933686, 24961472		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	LHGDN	16301823		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	33003561	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	16221215, 30628684		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	LHGDN	16221215		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	Pubtator	16221215	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	16221215, 22648267, 27664953	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	12215463, 15304560, 16221215, 16484615, 18653620, 19584721, 19764891, 22648267, 23933686, 27298316, 27664953, 28679951, 28787716, 30524295, 31280647, 31600722, 31815093 View all (2 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	LHGDN	15304560, 16221215		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypoxia	Hypoxia	Pubtator	27251632	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	27560795	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	31815093		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	28787716, 29788407		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal Neoplasms	BEFREE	20110688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	21430556, 31485662		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	10589686, 15304560, 31013255		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	32015442	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	15304560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	CTD_human_DG	17330099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	12521301, 26419593, 30034594		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	28662101	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	26474695		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	26474695		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	22832853, 25705664		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	PSYGENET_DG	22832853		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant neoplasm of breast	Breast Cancer	BEFREE	15679045, 23581296, 26419593, 30866857, 31694887		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	28177128		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	17571248		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	19383827		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	15981206, 18794135, 21563193, 24615402, 28336914, 29017179, 29609629, 31187175		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	26942879		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	29055016		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	21478911, 23108393, 27771704, 28177128, 28529581, 29267206, 29609629, 29807219, 31136958, 31163384, 31539779		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	31136958		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	15695387		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	24685888		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	30728070	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	26219339		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	26219339	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	31153932, 31281445, 31725056		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	18209482, 20541034, 31600722		★★★★★ ★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	25747134, 28529452		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	31641423	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	26827666	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	21478911		★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Multiple Sclerosis	Multiple Sclerosis	BEFREE	28467798, 28652101		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	28980287		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	19383827, 20541034, 21079778, 21563193, 23055545, 23581296, 23933686, 26942879, 27771704, 28109464, 28545025, 28992614, 29170478, 29609629, 29976632, 30034594 View all (1 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
NEPHRONOPHTHISIS 2	Nephronophthisis	BEFREE	28978526		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	11907829		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	16125969, 29807219		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 2	Neurofibromatosis	BEFREE	26219339		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nodular Lymphocyte Predominant Hodgkin Lymphoma	Classical Hodgkin lymphoma	BEFREE	26658840		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	22240294, 26548813, 28338770, 29328462		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	19764891, 26833885, 29202451, 29321171, 30118514, 31617909		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	31330080	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	31694887		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	39884015	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	19383827		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	32878513	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic disorder	Pubtator	29249830	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	16125969		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinsonian Disorders	Parkinson Disease	BEFREE	29604467		★★★★★ ★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	22137507, 26506154		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	15981206, 18794135, 21563193, 24615402, 28336914, 29017179, 29609629, 31187175		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasias	Prostatic Neoplasms	BEFREE	15981206		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	18794135, 21563193, 35075115	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	33783250	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pseudohypoaldosteronism	Pseudohypoaldosteronism	LHGDN	17317952		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pseudohypoaldosteronism, Type I	Pseudohypoaldosteronism	BEFREE	17317952		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pseudohypoaldosteronism, Type I, Autosomal Dominant	Pseudohypoaldosteronism	BEFREE	17317952		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	17571248		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	30524295		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	27960157, 28992614	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	28992614		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma Embryonal	Rhabdomyosarcoma	Pubtator	28992614	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	25705664		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sepsis	Sepsis	Pubtator	37336980	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	22240294		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	39272022	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	31600722		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	26942879		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	26942879	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Symmetric Diabetic Proximal Motor Neuropathy	Symmetric Diabetic Proximal Motor Neuropathy	CTD_human_DG	16696316		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	29055016		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	29055016		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tongue Neoplasms	Tongue cancer	Pubtator	25749387	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	29788407		★★★★★ ★☆☆☆☆ Found in Text Mining only
Undifferentiated carcinoma	Carcinoma	CTD_human_DG	16316942		★★★★★ ★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	22832853		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Unipolar Depression	Mental Depression	PSYGENET_DG	22832853		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uremia	Uremia	CTD_human_DG	18768591		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Vascular Calcification	Vascular calcification	Pubtator	33003561	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	26833885, 31815093		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular arrhythmia	Ventricular arrhythmia	BEFREE	23019294		★★★★★ ★☆☆☆☆ Found in Text Mining only

SGK1 (serum/glucocorticoid regulated kinase 1)