Gene Gene information from NCBI Gene database.
Entrez ID 64419
Gene name Myotubularin related protein 14
Gene symbol MTMR14
Synonyms (NCBI Gene)
C3orf29
Chromosome 3
Chromosome location 3p25.3
Summary This gene encodes a myotubularin-related protein. The encoded protein is a phosphoinositide phosphatase that specifically dephosphorylates phosphatidylinositol 3,5-biphosphate and phosphatidylinositol 3-phosphate. Mutations in this gene are correlated wit
SNPs SNP information provided by dbSNP.
3
SNP ID Visualize variation Clinical significance Consequence
rs121434509 G>A Risk-factor Non coding transcript variant, missense variant, coding sequence variant
rs121434510 A>G Risk-factor Non coding transcript variant, missense variant, coding sequence variant
rs375826804 C>T Conflicting-interpretations-of-pathogenicity Non coding transcript variant, coding sequence variant, intron variant, synonymous variant
miRNA miRNA information provided by mirtarbase database.
81
miRTarBase ID miRNA Experiments Reference
MIRT021522 hsa-miR-145-5p Reporter assay;Microarray 21351259
MIRT051539 hsa-let-7e-5p CLASH 23622248
MIRT051539 hsa-let-7e-5p CLASH 23622248
MIRT049480 hsa-miR-92a-3p CLASH 23622248
MIRT041555 hsa-miR-193b-3p CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
16
GO ID Ontology Definition Evidence Reference
GO:0001726 Component Ruffle IDA 17008356
GO:0004438 Function Phosphatidylinositol-3-phosphate phosphatase activity IBA
GO:0004438 Function Phosphatidylinositol-3-phosphate phosphatase activity IDA 17008356
GO:0004438 Function Phosphatidylinositol-3-phosphate phosphatase activity IEA
GO:0004438 Function Phosphatidylinositol-3-phosphate phosphatase activity TAS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
611089 26190 ENSG00000163719
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8NCE2
Protein name Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR14 (EC 3.1.3.95) (HCV NS5A-transactivated protein 4 splice variant A-binding protein 1) (NS5ATP4ABP1) (Myotubularin-related protein 14) (Phosphatidylinositol-3-phosphate phosphatase) (hJumpy)
Protein function Lipid phosphatase that specifically dephosphorylates the D-3 position of phosphatidylinositol 3-phosphate and phosphatidylinositol 3,5-bisphosphate, generating phosphatidylinositol and phosphatidylinositol 5-phosphate. {ECO:0000269|PubMed:170083
Family and domains
Tissue specificity TISSUE SPECIFICITY: Expressed in various tissues, including heart, skeletal muscle, placenta, liver, lung, kidney and pancreas. {ECO:0000269|PubMed:17008356}.
Sequence
MAGARAAAAAASAGSSASSGNQPPQELGLGELLEEFSRTQYRAKDGSGTGGSKVERIEKR
CLELFGRDYCFSVIPNTNGDICGHYPRHIVFLEYESSEKEKDTFESTVQVSKLQDLIHRS
KMARCRGRFVCPVILFKGKHICRSATLAGWGELYGRSGYNYFFSGGADDAWADVEDVTEE
DCALRSGDTHLFDKVRGYDIKLLRYLSVKYICDLMVENKKVKFGMNVTSSEKVDKAQRYA
DFTLLSIPYPGCEFFKEYKDRDYMAEGLIFNWKQDYVDAPLSIPDFLTHSLNIDWSQYQC
WDLVQQTQNYLKLLLSLVNSDDDSGLLVHCISGWDRTPLFISLLRLSLWADGLIHTSLKP
TEILYLTVAYDWFLFGHMLVDRLSKGEEIFFFCFNFLKHITSEEFSALKTQRRKSLPARD
GGFTLEDICMLRRKDRGSTTSLGSDFSLVMESSPGATGSFTYEAVELVPAGAPTQAAWRK
SHSSSPQSVLWNRPQPSEDRLPSQQGLAEARSSSSSSSNHSDNFFRMGSSPLEVPKPRSV
DHPLPGSSLSTDYGSWQMVTGCGSIQERAVLHTDSSLPFSFPDELPNSCLLAALSDRETR
LQEVRSAFLAAYSSTVGLRAVAPSPSGAIGGLLEQFARGVGLRSISSNAL
Sequence length 650
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Autophagy - animal
  Macroautophagy
Synthesis of PIPs at the plasma membrane
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
19
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ALZHEIMER DISEASE GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Autosomal dominant centronuclear myopathy Conflicting classifications of pathogenicity; Uncertain significance ClinVar
ClinVar, Orphanet
ClinVar, Orphanet
★★★☆☆
Reported in Unknown/Other Associations (≥2 sources)
CARCINOMA, OVARIAN EPITHELIAL CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Chronic lymphocytic leukemia/small lymphocytic lymphoma Conflicting classifications of pathogenicity ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Asphyxia Neonatorum Postnatal asphyxia HPO_DG
★☆☆☆☆
Found in Text Mining only
Autosomal dominant centronuclear myopathy Centronuclear Myopathy Orphanet
★★★☆☆
Reported in Unknown/Other Associations (≥2 sources)
Autosomal Dominant Myotubular Myopathy Centronuclear Myopathy CTD_human_DG
★☆☆☆☆
Found in Text Mining only
Autosomal Recessive Centronuclear Myopathy Centronuclear Myopathy CTD_human_DG
★☆☆☆☆
Found in Text Mining only
Blepharoptosis Ptosis HPO_DG
★☆☆☆☆
Found in Text Mining only
Carcinoma, Ovarian Epithelial Ovarian Epithelial carcinoma CTD_human_DG 30365097
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Cardiomyopathies Cardiomyopathy BEFREE 30586604
★☆☆☆☆
Found in Text Mining only
Centronuclear myopathy Centronuclear Myopathy BEFREE 18817572, 30528881, 31029679
★☆☆☆☆
Found in Text Mining only
Centronuclear myopathy Centronuclear Myopathy GENOMICS_ENGLAND_DG 19465920
★☆☆☆☆
Found in Text Mining only
Centronuclear myopathy Centronuclear Myopathy CTD_human_DG
★☆☆☆☆
Found in Text Mining only