RGS18 (regulator of G protein signaling 18)

Gene

• Entrez ID: 64407
• Gene name: Regulator of G protein signaling 18
• Gene symbol: RGS18
• Synonyms (NCBI Gene): RGS13
• Chromosome: 1
• Chromosome location: 1q31.2
• Summary: This gene encodes a member of the regulator of G-protein signaling family. This protein is contains a conserved, 120 amino acid motif called the RGS domain. The protein attenuates the signaling activity of G-proteins by binding to activated, GTP-bound G a

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT017654	hsa-miR-335-5p	Microarray	18185580
MIRT1304261	hsa-miR-1270	CLIP-seq
MIRT1304262	hsa-miR-1305	CLIP-seq
MIRT1304263	hsa-miR-150	CLIP-seq
MIRT1304264	hsa-miR-23a	CLIP-seq
MIRT1304265	hsa-miR-23b	CLIP-seq
MIRT1304266	hsa-miR-23c	CLIP-seq
MIRT1304267	hsa-miR-3162-3p	CLIP-seq
MIRT1304268	hsa-miR-4254	CLIP-seq
MIRT1304269	hsa-miR-4511	CLIP-seq
MIRT1304270	hsa-miR-4683	CLIP-seq
MIRT1304271	hsa-miR-4713-5p	CLIP-seq
MIRT1304272	hsa-miR-5096	CLIP-seq
MIRT1304273	hsa-miR-532-3p	CLIP-seq
MIRT1304274	hsa-miR-548b-3p	CLIP-seq
MIRT1304275	hsa-miR-619	CLIP-seq
MIRT1304276	hsa-miR-620	CLIP-seq
MIRT2314901	hsa-miR-4670-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003924	Function	GTPase activity	IEA
GO:0003924	Function	GTPase activity	TAS
GO:0005096	Function	GTPase activator activity	IEA
GO:0005515	Function	Protein binding	IPI	21685921
GO:0005737	Component	Cytoplasm	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0008277	Process	Regulation of G protein-coupled receptor signaling pathway	IEA
GO:0009968	Process	Negative regulation of signal transduction	IEA

Other IDs

• MIM: 607192
• HGNC: 14261
• e!Ensembl: ENSG00000150681

Protein

• UniProt ID: Q9NS28
• Protein name: Regulator of G-protein signaling 18 (RGS18)
• Protein function: Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. Binds to G(i) alpha-1, G(i) alpha-2, G(i) alpha-3 and G(q) alpha. {ECO:0000269|PubMed:11042171, E
• PDB: 2DLV, 2JM5, 2OWI
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00615	RGS	86 → 201	Regulator of G protein signaling domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in peripheral leukocytes, bone marrow, platelet, spleen and fetal liver. {ECO:0000269|PubMed:11042171, ECO:0000269|PubMed:11955952}.
• Sequence:

  METTLLFFSQINMCESKEKTFFKLIHGSGKEETSKEAKIRAKEKRNRLSLLVQKPEFHED
  TRSSRSGHLAKETRVSPEEAVKWGESFDKLLSHRDGLEAFTRFLKTEFSEENIEFWIACE
  DFKKSKGPQQIHLKAKAIYEKFIQTDAPKEVNLDFHTKEVITNSITQPTLHSFDAAQSRV
  YQLMEQDSYTRFLKSDIYLDLMEGRPQRPTNLRRRSRSFTCNEFQDVQSDVAIWL

• Sequence length: 235

Pathways

Reactome:

G alpha (q) signalling events
G alpha (i) signalling events

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BLOOD PLATELET DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Blood Platelet Disorders	Platelet disorder	Pubtator	34131117	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	16565322		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	34131117	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASCAT_DG	31264924		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Hemorrhage	Gastrointestinal hemorrhage	Pubtator	34131117	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	19131553	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	16565322		★☆☆☆☆ Found in Text Mining only
Maculopathy with diabetes mellitus	Diabetic maculopathy	GWASCAT_DG	31264924		★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	BEFREE	12970790		★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	LHGDN	12970790		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	30655761		★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	12970790		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	33845140	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	30655761		★☆☆☆☆ Found in Text Mining only
Tetralogy of Fallot	Tetralogy of fallot	Pubtator	37740059	Associate	★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	34131117	Associate	★☆☆☆☆ Found in Text Mining only
Trisomy	Trisomy	Pubtator	18974375	Associate	★☆☆☆☆ Found in Text Mining only