SFTPC (surfactant protein C)

Gene

• Entrez ID: 6440
• Gene name: Surfactant protein C
• Gene symbol: SFTPC
• Synonyms (NCBI Gene): BRICD6, PSP-C, SFTP2, SMDP2, SP-C, SP5
• Chromosome: 8
• Chromosome location: 8p21.3
• Summary: This gene encodes the pulmonary-associated surfactant protein C (SPC), an extremely hydrophobic surfactant protein essential for lung function and homeostasis after birth. Pulmonary surfactant is a surface-active lipoprotein complex composed of 90% lipids

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs121917834	T>A,C	Pathogenic	Missense variant, coding sequence variant
rs121917836	G>A	Pathogenic	Intron variant, coding sequence variant, missense variant
rs1563221666	C>T	Likely-pathogenic	Coding sequence variant, missense variant, intron variant
rs1586421317	T>C	Likely-pathogenic	Missense variant, coding sequence variant

Transcription factors

Transcription factor	Regulation	Reference
PLAGL2	Activation	17618602;18655774

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	19815549, 25416956, 25686087, 25910212, 26871637, 31515488, 32296183, 33961781
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0007585	Process	Respiratory gaseous exchange by respiratory system	IEA
GO:0042599	Component	Lamellar body	TAS
GO:0042802	Function	Identical protein binding	IPI	25416956, 25910212, 31515488, 32296183
GO:0045334	Component	Clathrin-coated endocytic vesicle	TAS
GO:0097208	Component	Alveolar lamellar body	IBA
GO:0097486	Component	Multivesicular body lumen	TAS

Other IDs

• MIM: 178620
• HGNC: 10802
• e!Ensembl: ENSG00000168484

Protein

• UniProt ID: P11686
• Protein name: Surfactant protein C (SP-C) (Pulmonary surfactant-associated protein C) (Pulmonary surfactant-associated proteolipid SPL(Val)) (SP5)
• Protein function: Pulmonary surfactant associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces.
• PDB: 2YAD, 8OVI, 8OX2
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF08999	SP_C-Propep	1 → 93	Surfactant protein C, N terminal propeptide	Domain
  PF04089	BRICHOS	96 → 196	BRICHOS domain	Domain

• Sequence:

  MDVGSKEVLMESPPDYSAAPRGRFGIPCCPVHLKRLLIVVVVVVLIVVVIVGALLMGLHM
  SQKHTEMVLEMSIGAPEAQQRLALSEHLVTTATFSIGSTGLVVYDYQQLLIAYKPAPGTC
  CYIMKIAPESIPSLEALNRKVHNFQMECSLQAKPAVPTSKLGQAEGRDAGSAPSGGDPAF
  LGMAVNTLCGEVPLYYI

• Sequence length: 197

Pathways

Reactome:

Surfactant metabolism
Defective pro-SFTPC causes pulmonary surfactant metabolism dysfunction 2 (SMDP2) and respiratory distress syndrome (RDS)
Defective CSF2RB causes pulmonary surfactant metabolism dysfunction 5 (SMDP5)
Defective CSF2RA causes pulmonary surfactant metabolism dysfunction 4 (SMDP4)

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Hereditary pulmonary alveolar proteinosis	Likely pathogenic; Pathogenic	rs2538945227, rs372529179, rs1003901489, rs2538945951, rs2538945800, rs2538948503, rs2538948539, rs121917834	RCV002451823 RCV002320976 RCV002454674 RCV002332336 RCV002333061 RCV002342683 RCV002342936 RCV002415413	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Interstitial lung disease 2	Likely pathogenic	rs1586421317	RCV000988043	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Pulmonary fibrosis	Pathogenic	rs121917834	RCV002509156	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
SFTPC-related disorder	Likely pathogenic	rs1563221666	RCV003411688	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Surfactant metabolism dysfunction, pulmonary, 2	Likely pathogenic; Pathogenic	rs2131820994, rs2131817329, rs2131819081, rs2131815446, rs1586422427, rs121917834, rs121917835, rs121918559, rs121917836, rs121918560, rs1209953579, rs1554476282	RCV001375872 RCV001808056 RCV004785439 RCV002276254 RCV000014094 RCV000014095 RCV000014097 RCV000014098 RCV000014099 RCV000014100 RCV000014101 RCV004555153 RCV003446272	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ASTHMA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE AIRWAY DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC RESPIRATORY DISTRESS WITH SURFACTANT METABOLISM DEFICIENCY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IDIOPATHIC PULMONARY FIBROSIS	—	CTD, Disgenet, Orphanet CTD, Disgenet, Orphanet CTD, Disgenet, Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTERSTITIAL LUNG DISEASE DUE TO SP-C DEFICIENCY	—	Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG DISEASES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG DISEASES, INTERSTITIAL	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOGENESIS IMPERFECTA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYCYSTIC OVARY SYNDROME	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PULMONARY ALVEOLAR PROTEINOSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Surfactant Metabolism Dysfunction, Dominant	Benign; Likely benign; Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SURFACTANT DYSFUNCTION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Surfactant metabolism dysfunction, pulmonary, 1	Uncertain significance	ClinVar Disgenet	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	BEFREE	1394139, 9191473		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	16688788, 28089356, 28653505, 31379200		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	CTD_human_DG	25851810		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	17121584		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	LHGDN	17121584		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	19910179	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Diseases	Autoimmune disease	Pubtator	24098648	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	31833519		★☆☆☆☆ Found in Text Mining only
Bronchiectasis	Bronchiectasis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Bronchioloalveolar Adenocarcinoma	Lung adenocarcinoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	14735158, 23775869, 30566624		★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary dysplasia	Pubtator	17264398	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	16085219, 7713515		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	31379200		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	35909187	Associate	★☆☆☆☆ Found in Text Mining only
Centriacinar Emphysema	Pulmonary Emphysema	BEFREE	21397355		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	24098648	Associate	★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	21668643		★☆☆☆☆ Found in Text Mining only
Chronic lung disease	Lung Diseases	BEFREE	10696076, 12667827, 14525980		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	19910179, 27875656		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic respiratory distress with surfactant metabolism deficiency	Respiratory Distress With Surfactant Metabolism Deficiency	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cirrhosis	Cirrhosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congenital diaphragmatic hernia	Congenital diaphragmatic hernia	BEFREE	12904592, 28188034		★☆☆☆☆ Found in Text Mining only
Congenital hypoplasia of lung	Pulmonary hypoplasia	BEFREE	28188034		★☆☆☆☆ Found in Text Mining only
Congenital peripheral neuropathy	Congenital Peripheral Neuropathy	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Cyst	Cyst	BEFREE	30560893		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	30333828		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	30333828	Associate	★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	12114016, 15709974		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	30338211		★☆☆☆☆ Found in Text Mining only
Disorder of skeletal muscle	Disorder Of Skeletal Muscle	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Dysequilibrium syndrome	Dysequilibrium Syndrome	BEFREE	20539253		★☆☆☆☆ Found in Text Mining only
Familial Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	16926644		★☆☆☆☆ Found in Text Mining only
Familial Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	Pubtator	37962678	Associate	★☆☆☆☆ Found in Text Mining only
Gastroesophageal reflux disease	Gastroesophageal Reflux Disease	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hamman-Rich Disease	Diffuse interstitial pulmonary fibrosis	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Hamman-Rich syndrome	Hamman-Rich syndrome	BEFREE	11991887, 17005585		★☆☆☆☆ Found in Text Mining only
Hamman-Rich syndrome	Hamman-Rich syndrome	ORPHANET_DG	15516475		★☆☆☆☆ Found in Text Mining only
Hay-Wells syndrome	Hay-Wells syndrome	BEFREE	30333529		★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	35909187	Associate	★☆☆☆☆ Found in Text Mining only
Hermanski-Pudlak Syndrome	Hermansky-Pudlak Syndrome	BEFREE	29997245		★☆☆☆☆ Found in Text Mining only
Honeycomb lung	Honeycomb lung	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hyaline Membrane Disease	Hyaline Membrane Disease	ORPHANET_DG			★☆☆☆☆ Found in Text Mining only
Hydrocephalus	Hydrocephalus	BEFREE	31127529		★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	8559602		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	12896876, 24565845		★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	Pubtator	29569581	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	20957739		★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	HPO_DG			★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	13680361, 15133475, 15516475, 15863652, 17005585, 18390830, 20371530, 20656946, 22287606, 27630174, 27967234, 29567124, 29920187, 30910861, 30955586, 31178143		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	15133475, 15516475, 18390830, 20371530, 21543794, 21613931, 21828032, 22295148, 28066036, 37978501	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	ORPHANET_DG	15516475		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Idiopathic pulmonary fibrosis	Pulmonary Fibrosis	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	CTD_human_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Infant acute respiratory distress syndrome	Respiratory Distress Syndrome	Orphanet			★☆☆☆☆ Found in Text Mining only
Interstitial lung disease due to SP-C deficiency	Interstitial Lung Disease	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lipoid Proteinosis of Urbach and Wiethe	Lipoid Proteinosis	BEFREE	21707890		★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	11001826, 12176392, 14525980, 14977415, 15039969, 15709974, 15756222, 16355106, 16782390, 17121584, 17429902, 17597647, 19443464, 19735006, 20658481, 23719253, 24024739, 25782673, 26186947, 27362365, 30357986, 9813382		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung diseases	Lung Diseases	LHGDN	14977415		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Diseases	Lung disease	Pubtator	16042774, 17586700, 19443464, 19910179, 20658481, 21707890, 21867529, 22016030, 24024739, 25782673, 27337142, 34918679, 36135709, 36642519	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Diseases Interstitial	Lung disease	Pubtator	15133475, 16361824, 16709565, 17586700, 19443464, 19472327, 19910179, 20371530, 20463293, 21613931, 21707890, 22016030, 22461427, 24024739, 25344067, 25657025, 25858779, 26925580, 28295039, 28495692, 29569581, 29805340, 31462320, 32195974, 33179299, 36642519, 37955668	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	37266432	Inhibit	★☆☆☆☆ Found in Text Mining only
Lung Diseases Obstructive	Lung disease	Pubtator	19910179	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	GENOMICS_ENGLAND_DG	11207353		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Diseases, Interstitial	Lung Diseases	BEFREE	11445799, 11806849, 14525980, 14656744, 14735158, 14977415, 15039969, 15133475, 15293602, 15557112, 15709974, 15756222, 15819986, 16449190, 17005585, 17142157, 17575475, 19220077, 19304906, 19443464, 19910179, 20371530, 20403820, 21092132, 21668643, 21707890, 22458263, 23443156, 23701443, 23736009, 24024739, 24099305, 24142519, 24347114, 25344067, 25657025, 25858779, 26041777, 26375473, 26375475, 26925580, 28157837, 28295039, 30910861, 31462320		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Diseases, Interstitial	Lung Diseases	LHGDN	11893657, 11991887, 14525980, 15133475, 15293602, 18643778		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Diseases, Interstitial	Lung Diseases	CLINVAR_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Diseases, Obstructive	Lung Diseases	BEFREE	19910179		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	1394139, 16085219, 24213573		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	16085219, 38575158	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	31833519		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	31379200		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	21397355		★☆☆☆☆ Found in Text Mining only
Myopathy	Myopathy	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Necrotizing enterocolitis in fetus OR newborn	Necrotizing Enterocolitis	BEFREE	30148762		★☆☆☆☆ Found in Text Mining only
Neonatal Hypotonia	Hypotonia	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	19847808, 9191473		★☆☆☆☆ Found in Text Mining only
Neuroendocrine cell hyperplasia of infancy	Neuroendocrine Cell Hyperplasia	BEFREE	19237389		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	16085219		★☆☆☆☆ Found in Text Mining only
Oculocutaneous albinism type 2	Oculocutaneous albinism	Pubtator	30211653	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	CTD_human_DG	21411543		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Presenile dementia	Senile Dementia	BEFREE	12114016		★☆☆☆☆ Found in Text Mining only
Pulmonary Alveolar Proteinosis	Alveolar proteinosis	GENOMICS_ENGLAND_DG	11207353		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Alveolar Proteinosis	Alveolar proteinosis	BEFREE	15039969, 8609219		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Alveolar Proteinosis	Pulmonary alveolar proteinosis	Pubtator	24859540	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Alveolar Proteinosis	Alveolar proteinosis	CLINVAR_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Alveolar Proteinosis	Alveolar proteinosis	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Alveolar Proteinosis Acquired	Pulmonary alveolar proteinosis	Pubtator	21707890	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	HPO_DG			★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	28552795, 29326605		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	14674994, 15516475, 15863652, 17005585, 18037811, 20656946, 21828032, 24047351, 27694932, 29920187, 30102252, 30333529, 30560893, 31178143, 8879184		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Pulmonary Fibrosis	Pulmonary fibrosis	Pubtator	15516475, 17005585, 21828032	Associate	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Pulmonary Fibrosis	Pulmonary Fibrosis	HPO_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Respiration Disorders	Respiration Disorders	BEFREE	14735158		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome	Respiratory Distress Syndrome	BEFREE	11001826, 16728712, 21668643, 23027351, 27973472, 28465315		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome	Respiratory Distress Syndrome	ORPHANET_DG			★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	11001826, 16728712, 21668643, 23027351, 27973472, 28465315, 29345196, 31694668		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Newborn	Congenital alveolar dysplasia	BEFREE	11001826, 12114016, 14735158, 16728712, 17127271, 17142161, 18317237, 20539253, 21668643, 23027351, 24047351, 27884070, 27973472, 28221717, 28295039, 28465315, 30357986, 30972750		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Newborn	Congenital alveolar dysplasia	ORPHANET_DG			★☆☆☆☆ Found in Text Mining only
Respiratory Failure	Respiratory Failure	BEFREE	17142157, 19217887, 23719253, 27362365, 29997245, 9506635		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory Tract Diseases	BEFREE	14735158		★☆☆☆☆ Found in Text Mining only
Sclerocystic Ovaries	Sclerocystic Ovaries	CTD_human_DG	21411543		★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	28707162		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	16085219		★☆☆☆☆ Found in Text Mining only
Surfactant Dysfunction	Pulmonary surfactant metabolism dysfunction	Pubtator	18317237, 24024739, 25782673, 29255193	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SURFACTANT METABOLISM DYSFUNCTION, PULMONARY, 2 (disorder)	Pulmonary Surfactant Metabolism Dysfunction	GENOMICS_ENGLAND_DG	11207353, 19443464		★☆☆☆☆ Found in Text Mining only
SURFACTANT METABOLISM DYSFUNCTION, PULMONARY, 2 (disorder)	Pulmonary Surfactant Metabolism Dysfunction	UNIPROT_DG	11991887, 15039969, 15293602, 15557112, 15572558		★☆☆☆☆ Found in Text Mining only
SURFACTANT METABOLISM DYSFUNCTION, PULMONARY, 2 (disorder)	Pulmonary Surfactant Metabolism Dysfunction	CLINVAR_DG	15293602, 15572558, 19443464		★☆☆☆☆ Found in Text Mining only
SURFACTANT METABOLISM DYSFUNCTION, PULMONARY, 2 (disorder)	Pulmonary Surfactant Metabolism Dysfunction	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	Pubtator	20371530	Associate	★☆☆☆☆ Found in Text Mining only