Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	64395
Gene name	Germ cell-less 1, spermatogenesis associated
Gene symbol	GMCL1
Synonyms (NCBI Gene)	BTBD13GCLGCL1SPATA29
Chromosome	2
Chromosome location	2p13.3
Summary	This gene encodes a nuclear envelope protein that appears to be involved in spermatogenesis, either directly or by influencing genes that play a more direct role in the process. This multi-exon locus is the homolog of the mouse and drosophila germ cell-le

115

Show/Hide all (115)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022371	hsa-miR-124-3p	Microarray	18668037
MIRT679415	hsa-miR-3664-5p	HITS-CLIP	23824327
MIRT679414	hsa-miR-4639-3p	HITS-CLIP	23824327
MIRT679413	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT679412	hsa-miR-3135a	HITS-CLIP	23824327
MIRT679411	hsa-miR-4294	HITS-CLIP	23824327
MIRT679410	hsa-miR-6794-3p	HITS-CLIP	23824327
MIRT679409	hsa-miR-3672	HITS-CLIP	23824327
MIRT679408	hsa-miR-6864-3p	HITS-CLIP	23824327
MIRT679407	hsa-miR-8055	HITS-CLIP	23824327
MIRT679406	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT679415	hsa-miR-3664-5p	HITS-CLIP	23824327
MIRT679414	hsa-miR-4639-3p	HITS-CLIP	23824327
MIRT679413	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT679412	hsa-miR-3135a	HITS-CLIP	23824327
MIRT679411	hsa-miR-4294	HITS-CLIP	23824327
MIRT679410	hsa-miR-6794-3p	HITS-CLIP	23824327
MIRT679409	hsa-miR-3672	HITS-CLIP	23824327
MIRT679408	hsa-miR-6864-3p	HITS-CLIP	23824327
MIRT679407	hsa-miR-8055	HITS-CLIP	23824327
MIRT679406	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT1022411	hsa-miR-1257	CLIP-seq
MIRT1022412	hsa-miR-1262	CLIP-seq
MIRT1022413	hsa-miR-1290	CLIP-seq
MIRT1022414	hsa-miR-1296	CLIP-seq
MIRT1022415	hsa-miR-1299	CLIP-seq
MIRT1022416	hsa-miR-199a-3p	CLIP-seq
MIRT1022417	hsa-miR-199b-3p	CLIP-seq
MIRT1022418	hsa-miR-2116	CLIP-seq
MIRT1022419	hsa-miR-3074-3p	CLIP-seq
MIRT1022420	hsa-miR-3129-5p	CLIP-seq
MIRT1022421	hsa-miR-3167	CLIP-seq
MIRT1022422	hsa-miR-3662	CLIP-seq
MIRT1022423	hsa-miR-3910	CLIP-seq
MIRT1022424	hsa-miR-3927	CLIP-seq
MIRT1022425	hsa-miR-4263	CLIP-seq
MIRT1022426	hsa-miR-4289	CLIP-seq
MIRT1022427	hsa-miR-4314	CLIP-seq
MIRT1022428	hsa-miR-4328	CLIP-seq
MIRT1022429	hsa-miR-4503	CLIP-seq
MIRT1022430	hsa-miR-4512	CLIP-seq
MIRT1022431	hsa-miR-4650-3p	CLIP-seq
MIRT1022432	hsa-miR-4662a-5p	CLIP-seq
MIRT1022433	hsa-miR-4677-5p	CLIP-seq
MIRT1022434	hsa-miR-4701-3p	CLIP-seq
MIRT1022435	hsa-miR-4735-5p	CLIP-seq
MIRT1022436	hsa-miR-4760-5p	CLIP-seq
MIRT1022437	hsa-miR-4782-5p	CLIP-seq
MIRT1022438	hsa-miR-4803	CLIP-seq
MIRT1022439	hsa-miR-516b	CLIP-seq
MIRT1022440	hsa-miR-548ag	CLIP-seq
MIRT1022441	hsa-miR-548ai	CLIP-seq
MIRT1022442	hsa-miR-548an	CLIP-seq
MIRT1022443	hsa-miR-548c-3p	CLIP-seq
MIRT1022444	hsa-miR-561	CLIP-seq
MIRT1022445	hsa-miR-576-5p	CLIP-seq
MIRT1022446	hsa-miR-586	CLIP-seq
MIRT1022447	hsa-miR-616	CLIP-seq
MIRT1022448	hsa-miR-876-5p	CLIP-seq
MIRT1022449	hsa-miR-936	CLIP-seq
MIRT2002954	hsa-miR-1185	CLIP-seq
MIRT2002955	hsa-miR-1231	CLIP-seq
MIRT2002956	hsa-miR-3182	CLIP-seq
MIRT2002957	hsa-miR-3605-5p	CLIP-seq
MIRT2002958	hsa-miR-3679-5p	CLIP-seq
MIRT2002959	hsa-miR-3686	CLIP-seq
MIRT2002960	hsa-miR-4288	CLIP-seq
MIRT2002961	hsa-miR-4742-3p	CLIP-seq
MIRT2002962	hsa-miR-632	CLIP-seq
MIRT2236010	hsa-miR-106a	CLIP-seq
MIRT2236011	hsa-miR-106b	CLIP-seq
MIRT1022411	hsa-miR-1257	CLIP-seq
MIRT1022412	hsa-miR-1262	CLIP-seq
MIRT1022413	hsa-miR-1290	CLIP-seq
MIRT1022414	hsa-miR-1296	CLIP-seq
MIRT1022415	hsa-miR-1299	CLIP-seq
MIRT2236012	hsa-miR-1305	CLIP-seq
MIRT2236013	hsa-miR-17	CLIP-seq
MIRT1022416	hsa-miR-199a-3p	CLIP-seq
MIRT1022417	hsa-miR-199b-3p	CLIP-seq
MIRT2236014	hsa-miR-20a	CLIP-seq
MIRT2236015	hsa-miR-20b	CLIP-seq
MIRT2236016	hsa-miR-302a	CLIP-seq
MIRT2236017	hsa-miR-302b	CLIP-seq
MIRT2236018	hsa-miR-302c	CLIP-seq
MIRT2236019	hsa-miR-302d	CLIP-seq
MIRT2236020	hsa-miR-302e	CLIP-seq
MIRT1022419	hsa-miR-3074-3p	CLIP-seq
MIRT1022420	hsa-miR-3129-5p	CLIP-seq
MIRT1022421	hsa-miR-3167	CLIP-seq
MIRT2236021	hsa-miR-372	CLIP-seq
MIRT2236022	hsa-miR-373	CLIP-seq
MIRT2236023	hsa-miR-3973	CLIP-seq
MIRT1022427	hsa-miR-4314	CLIP-seq
MIRT1022428	hsa-miR-4328	CLIP-seq
MIRT2236024	hsa-miR-4502	CLIP-seq
MIRT1022430	hsa-miR-4512	CLIP-seq
MIRT2236025	hsa-miR-452	CLIP-seq
MIRT2236026	hsa-miR-4676-3p	CLIP-seq
MIRT1022434	hsa-miR-4701-3p	CLIP-seq
MIRT1022437	hsa-miR-4782-5p	CLIP-seq
MIRT1022439	hsa-miR-516b	CLIP-seq
MIRT2236027	hsa-miR-519d	CLIP-seq
MIRT2236028	hsa-miR-520a-3p	CLIP-seq
MIRT2236029	hsa-miR-520b	CLIP-seq
MIRT2236030	hsa-miR-520c-3p	CLIP-seq
MIRT2236031	hsa-miR-520d-3p	CLIP-seq
MIRT2236032	hsa-miR-520e	CLIP-seq
MIRT2236033	hsa-miR-520g	CLIP-seq
MIRT2236034	hsa-miR-520h	CLIP-seq
MIRT1022444	hsa-miR-561	CLIP-seq
MIRT2236035	hsa-miR-607	CLIP-seq
MIRT1022448	hsa-miR-876-5p	CLIP-seq
MIRT2236036	hsa-miR-93	CLIP-seq
MIRT1022449	hsa-miR-936	CLIP-seq

Show/Hide all (8)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	21145461, 21516116, 25910212, 26871637, 27107012, 28514442, 31515488, 32296183, 32814053, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0007281	Process	Germ cell development	IEA
GO:0007283	Process	Spermatogenesis	IEA
GO:0016363	Component	Nuclear matrix	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0042802	Function	Identical protein binding	IPI	27107012, 32296183

MIM	HGNC	e!Ensembl
618627	23843	ENSG00000087338

Q96IK5

Protein name

Germ cell-less protein-like 1 (Spermatogenesis-associated protein 29)

Protein function

Possible function in spermatogenesis. Enhances the degradation of MDM2 and increases the amount of p53 probably by modulating the nucleocytoplasmic transport (By similarity).

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00651	BTB	98 → 208	BTB/POZ domain	Domain
PF07707	BACK	213 → 301	BTB And C-terminal Kelch	Domain

Sequence

MGSLSSRVLRQPRPALAQQAQGARAGGSARRPDTGDDAAGHGFCYCAGSHKRKRSSGSFC
YCHPDSETDEDEEEGDEQQRLLNTPRRKKLKSTSKYIYQTLFLNGENSDIKICALGEEWS
LHKIYLCQSGYFSSMFSGSWKESSMNIIELEIPDQNIDVEALQVAFGSLYRDDVLIKPSR
VVAILAAACLLQLDGLIQQCGETMKETVNVKTVCGYYTSAGTYGLDSVKKKCLEWLLNNL
MTHQNVELFKELSINVMKQLIGSSNLFVMQVEMDIYTALKKWMFLQLVPSWNGSLKQLLT
ETDVWFSKQRKDFEGMAFLETEQGKPFVSVFRHLRLQYIISDLASARIIEQDAVVPSEWL
SSVYKQQWFAMLRAEQDSEVGPQEINKEELEGNSMRCGRKLAKDGEYCWRWTGFNFGFDL
LVTYTNRYIIFKRNTLNQPCSGSVSLQPRRSIAFRLRLASFDSSGKLICSRTTGYQILTL
EKDQEQVVMNLDSRLLIFPLYICCNFLYISPEKKN

Sequence length

515

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATRIAL FIBRILLATION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOEMBOLIC STROKE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL NEOPLASM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (15)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	20432501		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthenozoospermia	Asthenozoospermia	Pubtator	30544396	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	GWASCAT_DG	30061737		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	12081989, 12975258		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	12081989, 12975258		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	12081989, 12975258		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	28257130		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	20432501		★★★★★ ★☆☆☆☆ Found in Text Mining only
Globoid cell leukodystrophy	Globoid Cell Leukodystrophy	BEFREE	28115189, 9875712		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypospadias	Hypospadias	Pubtator	32728162	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	21277635		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	BEFREE	30335521		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	20180881		★★★★★ ★☆☆☆☆ Found in Text Mining only
Optic Atrophy, Hereditary, Leber	Hereditary Leber Optic Atrophy	BEFREE	27631475		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinopathy of Prematurity	Retinopathy	BEFREE	31157715		★★★★★ ★☆☆☆☆ Found in Text Mining only

GMCL1 (germ cell-less 1, spermatogenesis associated)