MMP25 (matrix metallopeptidase 25)

Gene

• Entrez ID: 64386
• Gene name: Matrix metallopeptidase 25
• Gene symbol: MMP25
• Synonyms (NCBI Gene): MMP-25, MMP20, MMP20A, MMPL1, MT-MMP 6, MT-MMP6, MT6-MMP, MT6MMP, MTMMP6
• Chromosome: 16
• Chromosome location: 16p13.3
• Summary: Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as art

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT051134	hsa-miR-16-5p	CLASH	23622248
MIRT038668	hsa-miR-181c-3p	CLASH	23622248
MIRT1153449	hsa-miR-1183	CLIP-seq
MIRT1153450	hsa-miR-1285	CLIP-seq
MIRT1153451	hsa-miR-1470	CLIP-seq
MIRT1153452	hsa-miR-1587	CLIP-seq
MIRT1153453	hsa-miR-1908	CLIP-seq
MIRT1153454	hsa-miR-3126-3p	CLIP-seq
MIRT1153455	hsa-miR-3180	CLIP-seq
MIRT1153456	hsa-miR-3180-3p	CLIP-seq
MIRT1153457	hsa-miR-3187-5p	CLIP-seq
MIRT1153458	hsa-miR-3196	CLIP-seq
MIRT1153459	hsa-miR-3689a-5p	CLIP-seq
MIRT1153460	hsa-miR-3689b	CLIP-seq
MIRT1153461	hsa-miR-3689e	CLIP-seq
MIRT1153462	hsa-miR-3689f	CLIP-seq
MIRT1153463	hsa-miR-378g	CLIP-seq
MIRT1153464	hsa-miR-4252	CLIP-seq
MIRT1153465	hsa-miR-4265	CLIP-seq
MIRT1153466	hsa-miR-4278	CLIP-seq
MIRT1153467	hsa-miR-4296	CLIP-seq
MIRT1153468	hsa-miR-4300	CLIP-seq
MIRT1153469	hsa-miR-4312	CLIP-seq
MIRT1153470	hsa-miR-4322	CLIP-seq
MIRT1153471	hsa-miR-4468	CLIP-seq
MIRT1153472	hsa-miR-4486	CLIP-seq
MIRT1153473	hsa-miR-4492	CLIP-seq
MIRT1153474	hsa-miR-4497	CLIP-seq
MIRT1153475	hsa-miR-4498	CLIP-seq
MIRT1153476	hsa-miR-4508	CLIP-seq
MIRT1153477	hsa-miR-4632	CLIP-seq
MIRT1153478	hsa-miR-4648	CLIP-seq
MIRT1153479	hsa-miR-4654	CLIP-seq
MIRT1153480	hsa-miR-4656	CLIP-seq
MIRT1153481	hsa-miR-4667-3p	CLIP-seq
MIRT1153482	hsa-miR-4675	CLIP-seq
MIRT1153483	hsa-miR-4691-3p	CLIP-seq
MIRT1153484	hsa-miR-4716-3p	CLIP-seq
MIRT1153485	hsa-miR-4741	CLIP-seq
MIRT1153486	hsa-miR-4746-5p	CLIP-seq
MIRT1153487	hsa-miR-4769-5p	CLIP-seq
MIRT1153488	hsa-miR-604	CLIP-seq
MIRT1153489	hsa-miR-612	CLIP-seq
MIRT1153490	hsa-miR-658	CLIP-seq
MIRT1153491	hsa-miR-663	CLIP-seq
MIRT1153492	hsa-miR-744	CLIP-seq
MIRT1153493	hsa-miR-762	CLIP-seq
MIRT1153494	hsa-miR-766	CLIP-seq
MIRT1153495	hsa-miR-920	CLIP-seq
MIRT1153496	hsa-miR-943	CLIP-seq
MIRT1551369	hsa-miR-1539	CLIP-seq
MIRT1153477	hsa-miR-4632	CLIP-seq
MIRT1153486	hsa-miR-4746-5p	CLIP-seq
MIRT1551369	hsa-miR-1539	CLIP-seq
MIRT2043925	hsa-miR-185	CLIP-seq
MIRT2043926	hsa-miR-2117	CLIP-seq
MIRT2043927	hsa-miR-4273	CLIP-seq
MIRT2043928	hsa-miR-4306	CLIP-seq
MIRT1153477	hsa-miR-4632	CLIP-seq
MIRT2043929	hsa-miR-4644	CLIP-seq
MIRT1153479	hsa-miR-4654	CLIP-seq
MIRT1153486	hsa-miR-4746-5p	CLIP-seq
MIRT2043930	hsa-miR-4768-5p	CLIP-seq
MIRT1153487	hsa-miR-4769-5p	CLIP-seq
MIRT1153494	hsa-miR-766	CLIP-seq
MIRT1153451	hsa-miR-1470	CLIP-seq
MIRT1551369	hsa-miR-1539	CLIP-seq
MIRT2273324	hsa-miR-4481	CLIP-seq
MIRT1153477	hsa-miR-4632	CLIP-seq
MIRT1153481	hsa-miR-4667-3p	CLIP-seq
MIRT2273325	hsa-miR-4745-5p	CLIP-seq
MIRT1153486	hsa-miR-4746-5p	CLIP-seq
MIRT2273326	hsa-miR-491-5p	CLIP-seq
MIRT1551369	hsa-miR-1539	CLIP-seq
MIRT2390983	hsa-miR-2355-3p	CLIP-seq
MIRT2390984	hsa-miR-3909	CLIP-seq
MIRT1153477	hsa-miR-4632	CLIP-seq
MIRT2390985	hsa-miR-4707-5p	CLIP-seq
MIRT1153486	hsa-miR-4746-5p	CLIP-seq
MIRT2390986	hsa-miR-4749-3p	CLIP-seq
MIRT2390987	hsa-miR-676	CLIP-seq
MIRT1551369	hsa-miR-1539	CLIP-seq
MIRT2431223	hsa-miR-3648	CLIP-seq
MIRT2431224	hsa-miR-4316	CLIP-seq
MIRT1153477	hsa-miR-4632	CLIP-seq
MIRT2431225	hsa-miR-4707-3p	CLIP-seq
MIRT1153486	hsa-miR-4746-5p	CLIP-seq
MIRT2465646	hsa-miR-1292	CLIP-seq
MIRT2465647	hsa-miR-331-3p	CLIP-seq
MIRT2465648	hsa-miR-4467	CLIP-seq
MIRT2465649	hsa-miR-4728-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004222	Function	Metalloendopeptidase activity	IBA
GO:0004222	Function	Metalloendopeptidase activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006508	Process	Proteolysis	IEA
GO:0006508	Process	Proteolysis	NAS	10706098
GO:0006954	Process	Inflammatory response	NAS	10628838
GO:0008233	Function	Peptidase activity	IEA
GO:0008237	Function	Metallopeptidase activity	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	NAS	11034316
GO:0016787	Function	Hydrolase activity	IEA
GO:0030198	Process	Extracellular matrix organization	IBA
GO:0030574	Process	Collagen catabolic process	IBA
GO:0031012	Component	Extracellular matrix	IEA
GO:0031012	Component	Extracellular matrix	NAS	10628838
GO:0035579	Component	Specific granule membrane	TAS
GO:0046872	Function	Metal ion binding	IEA
GO:0060022	Process	Hard palate development	IEA
GO:0098552	Component	Side of membrane	IEA

Other IDs

• MIM: 608482
• HGNC: 14246
• e!Ensembl: ENSG00000008516

Protein

• UniProt ID: Q9NPA2
• Protein name: Matrix metalloproteinase-25 (MMP-25) (EC 3.4.24.-) (Leukolysin) (Membrane-type matrix metalloproteinase 6) (MT-MMP 6) (MTMMP6) (Membrane-type-6 matrix metalloproteinase) (MT6-MMP) (MT6MMP)
• Protein function: May activate progelatinase A.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01471	PG_binding_1	25 → 85	Putative peptidoglycan binding domain	Domain
  PF00413	Peptidase_M10	114 → 280	Matrixin	Domain
  PF00045	Hemopexin	321 → 365	Hemopexin	Repeat
  PF00045	Hemopexin	370 → 412	Hemopexin	Repeat
  PF00045	Hemopexin	416 → 462	Hemopexin	Repeat
  PF00045	Hemopexin	464 → 506	Hemopexin	Repeat

• Tissue specificity: TISSUE SPECIFICITY: Expressed predominantly in leukocytes, lung and spleen. Expressed also in colon carcinoma, astrocytoma and glioblastomas.
• Sequence:

  MRLRLRLLALLLLLLAPPARAPKPSAQDVSLGVDWLTRYGYLPPPHPAQAQLQSPEKLRD
  AIKVMQRFAGLPETGRMDPGTVATMRKPRCSLPDVLGVAGLVRRRRRYALSGSVWKKRTL
  TWRVRSFPQSSQLSQETVRVLMSYALMAWGMESGLTFHEVDSPQGQEPDILIDFARAFHQ
  DSYPFDGLGGTLAHAFFPGEHPISGDTHFDDEETWTFGSKDGEGTDLFAVAVHEFGHALG
  LGHSSAPNSIMRPFYQGPVGDPDKYRLSQDDRDGLQQLYGKAPQTPYDKPTRKPLAPPPQ
  PPASPTHSPSFPIPDRCEGNFDAIANIRGETFFFKGPWFWRLQPSGQLVSPRPARLHRFW
  EGLPAQVRVVQAAYARHRDGRILLFSGPQFWVFQDRQLEGGARPLTELGLPPGEEVDAVF
  SWPQNGKTYLVRGRQYWRYDEAAARPDPGYPRDLSLWEGAPPSPDDVTVSNAGDTYFFKG
  AHYWRFPKNSIKTEPDAPQPMGPNWLDCPAPSSGPRAPRPPKATPVSETCDCQCELNQAA
  GRWPAPIPLLLLPLLVGGVASR

• Sequence length: 562

Pathways

KEGG:

Parathyroid hormone synthesis, secretion and action

Reactome:

Activation of Matrix Metalloproteinases
Neutrophil degranulation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Mendelian syndromes with cleft lip/palate	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OROFACIAL CLEFTING SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Age related macular degeneration	Age-related macular degeneration	BEFREE	26337002		★☆☆☆☆ Found in Text Mining only
Amelogenesis Imperfecta	Amelogenesis imperfecta	BEFREE	12648554, 16246936, 17552940, 18096894, 18434575, 19966041, 20938048, 22243262, 22538897, 23625376, 24319098, 26124219, 27146352, 28659819		★☆☆☆☆ Found in Text Mining only
Amelogenesis Imperfecta	Amelogenesis imperfecta	LHGDN	15744043		★☆☆☆☆ Found in Text Mining only
Amelogenesis Imperfecta	Amelogenesis imperfecta	Pubtator	18096894, 18434575, 19530186, 19966041, 20938048, 21597265, 22243262, 31999931, 33600052, 39273410	Associate	★☆☆☆☆ Found in Text Mining only
Amelogenesis Imperfecta	Amelogenesis imperfecta	HPO_DG			★☆☆☆☆ Found in Text Mining only
Amelogenesis Imperfecta hypomaturation type	Amelogenesis Imperfecta	ORPHANET_DG	15744043		★☆☆☆☆ Found in Text Mining only
Amelogenesis Imperfecta hypomaturation type	Amelogenesis imperfecta	Pubtator	16246936, 33600052	Associate	★☆☆☆☆ Found in Text Mining only
Amelogenesis imperfecta local hypoplastic form	Amelogenesis imperfecta	Pubtator	18096894	Associate	★☆☆☆☆ Found in Text Mining only
Amelogenesis Imperfecta, Hypomaturation Type, Iia2	Amelogenesis imperfecta	CLINVAR_DG	23625376, 28473773, 28659819		★☆☆☆☆ Found in Text Mining only
Amelogenesis Imperfecta, Hypomaturation Type, Iia2	Amelogenesis imperfecta	GENOMICS_ENGLAND_DG	28659819		★☆☆☆☆ Found in Text Mining only
Amelogenesis Imperfecta, Hypomaturation Type, Iia2	Amelogenesis imperfecta	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	37569643	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	30932369	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	36456645	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	GWASCAT_DG	29545352		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	30932369	Associate	★☆☆☆☆ Found in Text Mining only
Dental Caries	Dental caries	Pubtator	22330321, 32398053	Associate	★☆☆☆☆ Found in Text Mining only
Dental Enamel Hypoplasia	Dental enamel hypoplasia	Pubtator	31999931	Associate	★☆☆☆☆ Found in Text Mining only
Dentinogenesis Imperfecta	Dentinogenesis Imperfecta	BEFREE	17552940		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	GWASCAT_DG	30067105		★☆☆☆☆ Found in Text Mining only
Hypomaturation amelogenesis imperfecta	Hypomaturation Amelogenesis Imperfecta	Orphanet			★☆☆☆☆ Found in Text Mining only
Intraepithelial Neoplasia	Intraepithelial Neoplasia	BEFREE	25666817		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	GWASCAT_DG	29545352		★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	21466263		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	25666817, 30002682		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	33914777	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	27272780		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	25666817, 30002682		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	30932369		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	30002682		★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	30932369	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	30002682, 30932369	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11153928, 27272780		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	28924153		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	GWASCAT_DG	28924153		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	28924153	Associate	★☆☆☆☆ Found in Text Mining only
Odontogenic Tumors	Odontogenic Tumor	BEFREE	11706946, 15296943		★☆☆☆☆ Found in Text Mining only
Odontogenic Tumors	Odontogenic Tumor	LHGDN	15296943		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	25867973, 31406154	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	10531073		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	30002682, 30320380, 30932369, 32630820	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid cancer medullary	Medullary thyroid cancer	Pubtator	27620278	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	30932369		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasm	Uterine cervix neoplasm	BEFREE	30932369		★☆☆☆☆ Found in Text Mining only