Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	64377
Gene name	Carbohydrate sulfotransferase 8
Gene symbol	CHST8
Synonyms (NCBI Gene)	GALNAC4ST1GalNAc4STPSS3
Chromosome	19
Chromosome location	19q13.11
Summary	The protein encoded by this gene belongs to the sulfotransferase 2 family. It is predominantly expressed in the pituitary gland, and is localized to the golgi membrane. This protein catalyzes the transfer of sulfate to position 4 of non-reducing N-acetylg

Show/Hide all (28)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017236	hsa-miR-335-5p	Microarray	18185580
MIRT892634	hsa-miR-149	CLIP-seq
MIRT892635	hsa-miR-218	CLIP-seq
MIRT892636	hsa-miR-331-3p	CLIP-seq
MIRT892637	hsa-miR-636	CLIP-seq
MIRT892635	hsa-miR-218	CLIP-seq
MIRT892637	hsa-miR-636	CLIP-seq
MIRT892635	hsa-miR-218	CLIP-seq
MIRT892637	hsa-miR-636	CLIP-seq
MIRT892635	hsa-miR-218	CLIP-seq
MIRT892637	hsa-miR-636	CLIP-seq
MIRT892635	hsa-miR-218	CLIP-seq
MIRT1964563	hsa-miR-3157-5p	CLIP-seq
MIRT1964564	hsa-miR-4287	CLIP-seq
MIRT1964565	hsa-miR-4469	CLIP-seq
MIRT1964566	hsa-miR-4492	CLIP-seq
MIRT1964567	hsa-miR-4498	CLIP-seq
MIRT1964568	hsa-miR-4505	CLIP-seq
MIRT1964569	hsa-miR-4685-3p	CLIP-seq
MIRT1964570	hsa-miR-4691-3p	CLIP-seq
MIRT1964571	hsa-miR-4731-5p	CLIP-seq
MIRT1964572	hsa-miR-615-5p	CLIP-seq
MIRT892637	hsa-miR-636	CLIP-seq
MIRT1964573	hsa-miR-762	CLIP-seq
MIRT892635	hsa-miR-218	CLIP-seq
MIRT2200726	hsa-miR-3605-5p	CLIP-seq
MIRT2200727	hsa-miR-4459	CLIP-seq
MIRT892637	hsa-miR-636	CLIP-seq

Show/Hide all (19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IEA
GO:0000139	Component	Golgi membrane	TAS
GO:0001537	Function	Dermatan 4-sulfotransferase activity	IDA	10988300, 11001942, 11445554
GO:0001537	Function	Dermatan 4-sulfotransferase activity	IEA
GO:0001537	Function	Dermatan 4-sulfotransferase activity	TAS
GO:0005515	Function	Protein binding	IPI	32814053
GO:0005794	Component	Golgi apparatus	IEA
GO:0006790	Process	Sulfur compound metabolic process	IDA	11445554
GO:0007417	Process	Central nervous system development	NAS	10988300
GO:0008146	Function	Sulfotransferase activity	IBA
GO:0008146	Function	Sulfotransferase activity	IEA
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	NAS	10988300
GO:0016051	Process	Carbohydrate biosynthetic process	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0030166	Process	Proteoglycan biosynthetic process	IBA
GO:0030166	Process	Proteoglycan biosynthetic process	IDA	10988300
GO:0030166	Process	Proteoglycan biosynthetic process	IEA
GO:0042446	Process	Hormone biosynthetic process	IEP	10988300

MIM	HGNC	e!Ensembl
610190	15993	ENSG00000124302

Q9H2A9

Protein name

Carbohydrate sulfotransferase 8 (EC 2.8.2.-) (GalNAc-4-O-sulfotransferase 1) (GalNAc-4-ST1) (GalNAc4ST-1) (N-acetylgalactosamine-4-O-sulfotransferase 1)

Protein function

Catalyzes the transfer of sulfate to position 4 of non-reducing N-acetylgalactosamine (GalNAc) residues in both N-glycans and O-glycans. Required for biosynthesis of glycoprotein hormones lutropin and thyrotropin, by mediating sulfation of their

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03567	Sulfotransfer_2	182 → 417	Sulfotransferase family	Domain

Tissue specificity

TISSUE SPECIFICITY: Predominantly expressed in pituitary gland. In brain, it is expressed in pituitary gland, cerebellum, medulla oblongata, pons, thalamus and spinal cord. Expressed in the epidermis. Expressed at lower level in lung, spleen, adrenal glan

Sequence

MTLRPGTMRLACMFSSILLFGAAGLLLFISLQDPTELAPQQVPGIKFNIRPRQPHHDLPP
GGSQDGDLKEPTERVTRDLSSGAPRGRNLPAPDQPQPPLQRGTRLRLRQRRRRLLIKKMP
AAATIPANSSDAPFIRPGPGTLDGRWVSLHRSQQERKRVMQEACAKYRASSSRRAVTPRH
VSRIFVEDRHRVLYCEVPKAGCSNWKRVLMVLAGLASSTADIQHNTVHYGSALKRLDTFD
RQGILHRLSTYTKMLFVREPFERLVSAFRDKFEHPNSYYHPVFGKAILARYRANASREAL
RTGSGVRFPEFVQYLLDVHRPVGMDIHWDHVSRLCSPCLIDYDFVGKFESMEDDANFFLS
LIRAPRNLTFPRFKDRHSQEARTTARIAHQYFAQLSALQRQRTYDFYYMDYLMFNYSKPF
ADLY

Sequence length

424

Interactions

View interactions

	KEGG		Reactome
	Various types of N-glycan biosynthesis Metabolic pathways		Reactions specific to the complex N-glycan synthesis pathway

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (11)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATOPIC ECZEMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHST8-related disorder	Conflicting classifications of pathogenicity; Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DENTAL CARIES	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DYSLEXIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY SKIN DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PEELING SKIN SYNDROME 3	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Peeling skin syndrome type A	Conflicting classifications of pathogenicity	ClinVar GWAS catalog, Orphanet GWAS catalog, Orphanet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
PSORIASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (15)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Asthma	Asthma	BEFREE	20816195		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	20816195	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chromosome 11p11.2 Deletion Syndrome	11p11.2 Deletion Syndrome	BEFREE	22289416		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	GWASCAT_DG	25574825		★★★★★ ★☆☆☆☆ Found in Text Mining only
PEELING SKIN SYNDROME	Peeling Skin Syndrome	BEFREE	22289416, 28204496		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peeling Skin Syndrome	Peeling skin syndrome	Pubtator	22289416	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
PEELING SKIN SYNDROME	Peeling Skin Syndrome	CTD_human_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
PEELING SKIN SYNDROME 3	Peeling Skin Syndrome	GENOMICS_ENGLAND_DG	22289416		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PEELING SKIN SYNDROME 3	Peeling Skin Syndrome	ORPHANET_DG	22289416		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PEELING SKIN SYNDROME 3	Peeling Skin Syndrome	UNIPROT_DG	22289416		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PEELING SKIN SYNDROME 6	Peeling Skin Syndrome	ORPHANET_DG	22289416		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peeling skin syndrome type A	Peeling Skin Syndrome	Orphanet			★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Psoriasis	Psoriasis	GWASCAT_DG	25574825		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Systemic Scleroderma	Scleroderma	BEFREE	22289416		★★★★★ ★☆☆☆☆ Found in Text Mining only

CHST8 (carbohydrate sulfotransferase 8)