Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	64332
Gene name	NFKB inhibitor zeta
Gene symbol	NFKBIZ
Synonyms (NCBI Gene)	I-kappa-B-zetaIKBZINAPIkappaB-zetaMAILikB-zetaikappaBzeta
Chromosome	3
Chromosome location	3q12.3
Summary	This gene is a member of the ankyrin-repeat family and is induced by lipopolysaccharide (LPS). The C-terminal portion of the encoded product which contains the ankyrin repeats, shares high sequence similarity with the I kappa B family of proteins. The lat

Show/Hide all (79)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005083	hsa-miR-124-3p	Luciferase reporter assayqRT-PCRWestern blot	19502795
MIRT005083	hsa-miR-124-3p	Luciferase reporter assayqRT-PCRWestern blot	19502795
MIRT005083	hsa-miR-124-3p	Luciferase reporter assayqRT-PCRWestern blot	19502795
MIRT019222	hsa-miR-335-5p	Microarray	18185580
MIRT024334	hsa-miR-215-5p	Microarray	19074876
MIRT026903	hsa-miR-192-5p	Microarray	19074876
MIRT041268	hsa-miR-193b-3p	CLASH	23622248
MIRT1183568	hsa-miR-1283	CLIP-seq
MIRT1183569	hsa-miR-1285	CLIP-seq
MIRT1183570	hsa-miR-3145-5p	CLIP-seq
MIRT1183571	hsa-miR-3178	CLIP-seq
MIRT1183572	hsa-miR-3187-5p	CLIP-seq
MIRT1183573	hsa-miR-3616-5p	CLIP-seq
MIRT1183574	hsa-miR-3617	CLIP-seq
MIRT1183575	hsa-miR-3618	CLIP-seq
MIRT1183576	hsa-miR-3647-5p	CLIP-seq
MIRT1183577	hsa-miR-3664-3p	CLIP-seq
MIRT1183578	hsa-miR-3670	CLIP-seq
MIRT1183579	hsa-miR-4252	CLIP-seq
MIRT1183580	hsa-miR-4433	CLIP-seq
MIRT1183581	hsa-miR-4459	CLIP-seq
MIRT1183582	hsa-miR-4486	CLIP-seq
MIRT1183583	hsa-miR-451b	CLIP-seq
MIRT1183584	hsa-miR-4696	CLIP-seq
MIRT1183585	hsa-miR-4761-5p	CLIP-seq
MIRT1183586	hsa-miR-4768-3p	CLIP-seq
MIRT1183587	hsa-miR-4795-5p	CLIP-seq
MIRT1183588	hsa-miR-508-5p	CLIP-seq
MIRT1183589	hsa-miR-573	CLIP-seq
MIRT1183590	hsa-miR-612	CLIP-seq
MIRT1183591	hsa-miR-619	CLIP-seq
MIRT1183592	hsa-miR-641	CLIP-seq
MIRT1183593	hsa-miR-661	CLIP-seq
MIRT1183594	hsa-miR-766	CLIP-seq
MIRT1183570	hsa-miR-3145-5p	CLIP-seq
MIRT1183571	hsa-miR-3178	CLIP-seq
MIRT1183579	hsa-miR-4252	CLIP-seq
MIRT1183582	hsa-miR-4486	CLIP-seq
MIRT1183588	hsa-miR-508-5p	CLIP-seq
MIRT1183593	hsa-miR-661	CLIP-seq
MIRT1183594	hsa-miR-766	CLIP-seq
MIRT2282517	hsa-miR-124	CLIP-seq
MIRT1183569	hsa-miR-1285	CLIP-seq
MIRT2282518	hsa-miR-3122	CLIP-seq
MIRT1183572	hsa-miR-3187-5p	CLIP-seq
MIRT2282519	hsa-miR-338-3p	CLIP-seq
MIRT2282520	hsa-miR-3622b-5p	CLIP-seq
MIRT1183577	hsa-miR-3664-3p	CLIP-seq
MIRT1183578	hsa-miR-3670	CLIP-seq
MIRT2282521	hsa-miR-3689a-3p	CLIP-seq
MIRT2282522	hsa-miR-3689c	CLIP-seq
MIRT2282523	hsa-miR-3714	CLIP-seq
MIRT2282524	hsa-miR-3910	CLIP-seq
MIRT2282525	hsa-miR-3913-5p	CLIP-seq
MIRT2282526	hsa-miR-4310	CLIP-seq
MIRT1183580	hsa-miR-4433	CLIP-seq
MIRT1183581	hsa-miR-4459	CLIP-seq
MIRT2282527	hsa-miR-4514	CLIP-seq
MIRT2282528	hsa-miR-4692	CLIP-seq
MIRT1183585	hsa-miR-4761-5p	CLIP-seq
MIRT1183586	hsa-miR-4768-3p	CLIP-seq
MIRT2282529	hsa-miR-483-3p	CLIP-seq
MIRT2282530	hsa-miR-486-5p	CLIP-seq
MIRT2282531	hsa-miR-506	CLIP-seq
MIRT2282532	hsa-miR-556-5p	CLIP-seq
MIRT1183590	hsa-miR-612	CLIP-seq
MIRT1183593	hsa-miR-661	CLIP-seq
MIRT2580515	hsa-miR-3155	CLIP-seq
MIRT2580516	hsa-miR-3155b	CLIP-seq
MIRT2580517	hsa-miR-3174	CLIP-seq
MIRT2580518	hsa-miR-3659	CLIP-seq
MIRT2580519	hsa-miR-4645-3p	CLIP-seq
MIRT2580520	hsa-miR-4658	CLIP-seq
MIRT2580521	hsa-miR-4676-5p	CLIP-seq
MIRT2580522	hsa-miR-4755-3p	CLIP-seq
MIRT2580523	hsa-miR-484	CLIP-seq
MIRT2580524	hsa-miR-574-5p	CLIP-seq
MIRT2580525	hsa-miR-575	CLIP-seq
MIRT2580526	hsa-miR-621	CLIP-seq

Show/Hide all (2)

Transcription factor	Regulation	Reference
NFKB1	Unknown	20220144
RELA	Unknown	20220144

Show/Hide all (62)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0002224	Process	Toll-like receptor signaling pathway	IEA
GO:0002250	Process	Adaptive immune response	IEA
GO:0002285	Process	Lymphocyte activation involved in immune response	IEA
GO:0002317	Process	Plasma cell differentiation	IEA
GO:0002456	Process	T cell mediated immunity	IEA
GO:0002544	Process	Chronic inflammatory response	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003712	Function	Transcription coregulator activity	IEA
GO:0005515	Function	Protein binding	IPI	25107474
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0006325	Process	Chromatin organization	IEA
GO:0006338	Process	Chromatin remodeling	IEA
GO:0006366	Process	Transcription by RNA polymerase II	IEA
GO:0006954	Process	Inflammatory response	IEA
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0010467	Process	Gene expression	IEA
GO:0010468	Process	Regulation of gene expression	IBA
GO:0016064	Process	Immunoglobulin mediated immune response	IEA
GO:0016607	Component	Nuclear speck	IDA
GO:0019221	Process	Cytokine-mediated signaling pathway	IEA
GO:0030216	Process	Keratinocyte differentiation	IEA
GO:0030217	Process	T cell differentiation	IEA
GO:0031349	Process	Positive regulation of defense response	IEA
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0032980	Process	Keratinocyte activation	IEA
GO:0034097	Process	Response to cytokine	IEA
GO:0036464	Component	Cytoplasmic ribonucleoprotein granule	IDA
GO:0042100	Process	B cell proliferation	IEA
GO:0042789	Process	MRNA transcription by RNA polymerase II	IEA
GO:0043588	Process	Skin development	IEA
GO:0043616	Process	Keratinocyte proliferation	IEA
GO:0045063	Process	T-helper 1 cell differentiation	IEA
GO:0045190	Process	Isotype switching	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0048536	Process	Spleen development	IEA
GO:0048873	Process	Homeostasis of number of cells within a tissue	IEA
GO:0050729	Process	Positive regulation of inflammatory response	IMP	23071313
GO:0050776	Process	Regulation of immune response	IEA
GO:0050829	Process	Defense response to Gram-negative bacterium	IEA
GO:0050852	Process	T cell receptor signaling pathway	IEA
GO:0050852	Process	T cell receptor signaling pathway	ISS
GO:0050853	Process	B cell receptor signaling pathway	IEA
GO:0051593	Process	Response to folic acid	IEA
GO:0061436	Process	Establishment of skin barrier	IEA
GO:0070897	Process	Transcription preinitiation complex assembly	IEA
GO:0070974	Function	POU domain binding	IEA
GO:0071222	Process	Cellular response to lipopolysaccharide	IEA
GO:0071345	Process	Cellular response to cytokine stimulus	IEA
GO:0071560	Process	Cellular response to transforming growth factor beta stimulus	IEA
GO:0072539	Process	T-helper 17 cell differentiation	IEA
GO:0072718	Process	Response to cisplatin	IEA
GO:0090594	Process	Inflammatory response to wounding	IEA
GO:0097194	Process	Execution phase of apoptosis	IEA
GO:0097398	Process	Cellular response to interleukin-17	IEA
GO:0098773	Process	Skin epidermis development	IEA
GO:0140459	Process	Response to Gram-positive bacterium	IEA
GO:1904019	Process	Epithelial cell apoptotic process	IEA
GO:1990117	Process	B cell receptor apoptotic signaling pathway	IEA
GO:2000321	Process	Positive regulation of T-helper 17 cell differentiation	IEA
GO:2000321	Process	Positive regulation of T-helper 17 cell differentiation	ISS

MIM	HGNC	e!Ensembl
608004	29805	ENSG00000144802

Q9BYH8

Protein name

NF-kappa-B inhibitor zeta (I-kappa-B-zeta) (IkB-zeta) (IkappaBzeta) (IL-1 inducible nuclear ankyrin-repeat protein) (INAP) (Molecule possessing ankyrin repeats induced by lipopolysaccharide) (MAIL)

Protein function

Involved in regulation of NF-kappa-B transcription factor complexes (PubMed:16513645, PubMed:16622025). Inhibits NF-kappa-B activity without affecting its nuclear translocation upon stimulation (PubMed:16513645). Inhibits DNA-binding of RELA and

PDB

9BOR

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF12796	Ank_2	581 → 683	Ankyrin repeats (3 copies)	Repeat

Tissue specificity

TISSUE SPECIFICITY: Expressed at high levels in peripheral blood leukocytes and lung, at moderate levels in liver, placenta, and at low levels in spleen, kidney, skeletal muscle and heart. {ECO:0000269|PubMed:16513645}.

Sequence

MIVDKLLDDSRGGEGLRDAAGGCGLMTSPLNLSYFYGASPPAAAPGACDASCSVLGPSAP
GSPGSDSSDFSSASSVSSCGAVESRSRGGARAERQPVEPHMGVGRQQRGPFQGVRVKNSV
KELLLHIRSHKQKASGQAVDDFKTQGVNIEQFRELKNTVSYSGKRKGPDSLSDGPACKRP
ALLHSQFLTPPQTPTPGESMEDVHLNEPKQESSADLLQNIINIKNECSPVSLNTVQVSWL
NPVVVPQSSPAEQCQDFHGGQVFSPPQKCQPFQVRGSQQMIDQASLYQYSPQNQHVEQQP
HYTHKPTLEYSPFPIPPQSPAYEPNLFDGPESQFCPNQSLVSLLGDQRESENIANPMQTS
SSVQQQNDAHLHSFSMMPSSACEAMVGHEMASDSSNTSLPFSNMGNPMNTTQLGKSLFQW
QVEQEESKLANISQDQFLSKDADGDTFLHIAVAQGRRALSYVLARKMNALHMLDIKEHNG
QSAFQVAVAANQHLIVQDLVNIGAQVNTTDCWGRTPLHVCAEKGHSQVLQAIQKGAVGSN
QFVDLEATNYDGLTPLHCAVIAHNAVVHELQRNQQPHSPEVQELLLKNKSLVDTIKCLIQ
MGAAVEAKDRKSGRTALHLAAEEANLELIRLFLELPSCLSFVNAKAYNGNTALHVAASLQ
YRLTQLDAVRLLMRKGADPSTRNLENEQPVHLVPDGPVGEQIRRILKGKSIQQRAPPY

Sequence length

718

Interactions

View interactions

	KEGG
	Transcriptional misregulation in cancer

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (9)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
COLORECTAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEREDITARY NONPOLYPOSIS COLON CANCER	—	ClinGen, GenCC	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NFKBIZ-related disorder	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (26)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Behcet Syndrome	Behcet disease	Pubtator	26890122	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	35441810, 38066224	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal cancer, hereditary nonpolyposis, type 1	Colorectal Cancer	CLINGEN_DG	25058500		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	25058500	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	30902734		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	30902734		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	30902734		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	24637010		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	20177751		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	23064081	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	29601852		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	29311812		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	29311812		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Non-Polyposis Colon Cancer Type 2	Colorectal Cancer	CLINGEN_DG	25058500		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary non-polyposis colorectal cancer syndrome	Hereditary nonpolyposis colorectal cancer	CLINGEN_DG	25058500		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Nonpolyposis Colorectal Cancer	Colorectal Cancer	CLINGEN_DG	25058500		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Nonpolyposis Colorectal Neoplasms	Colorectal Neoplasms	CLINGEN_DG	25058500		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	36643579	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	26702065	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	22513784		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood disorder	Pubtator	23064081	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	20177751		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	27117051, 31577850, 32832675	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	28259733, 29938836, 31267486, 31622687		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	29601852		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	35777990	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

NFKBIZ (NFKB inhibitor zeta)