Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	643246
Gene name	Microtubule associated protein 1 light chain 3 beta 2
Gene symbol	MAP1LC3B2
Synonyms (NCBI Gene)	ATG8G
Chromosome	12
Chromosome location	12q24.22

Show/Hide all (95)

miRTarBase ID	miRNA	Experiments	Reference
MIRT028572	hsa-miR-30a-5p	Proteomics	18668040
MIRT1127716	hsa-miR-1178	CLIP-seq
MIRT1127717	hsa-miR-124	CLIP-seq
MIRT1127718	hsa-miR-1292	CLIP-seq
MIRT1127719	hsa-miR-141	CLIP-seq
MIRT1127720	hsa-miR-200a	CLIP-seq
MIRT1127721	hsa-miR-3614-5p	CLIP-seq
MIRT1127722	hsa-miR-3670	CLIP-seq
MIRT1127723	hsa-miR-3682-3p	CLIP-seq
MIRT1127724	hsa-miR-3714	CLIP-seq
MIRT1127725	hsa-miR-3910	CLIP-seq
MIRT1127726	hsa-miR-432	CLIP-seq
MIRT1127727	hsa-miR-4328	CLIP-seq
MIRT1127728	hsa-miR-4471	CLIP-seq
MIRT1127729	hsa-miR-452	CLIP-seq
MIRT1127730	hsa-miR-4633-3p	CLIP-seq
MIRT1127731	hsa-miR-4676-3p	CLIP-seq
MIRT1127732	hsa-miR-4677-3p	CLIP-seq
MIRT1127733	hsa-miR-4679	CLIP-seq
MIRT1127734	hsa-miR-483-3p	CLIP-seq
MIRT1127735	hsa-miR-506	CLIP-seq
MIRT1127736	hsa-miR-890	CLIP-seq
MIRT1127716	hsa-miR-1178	CLIP-seq
MIRT1551100	hsa-miR-320a	CLIP-seq
MIRT1551101	hsa-miR-320b	CLIP-seq
MIRT1551102	hsa-miR-320c	CLIP-seq
MIRT1551103	hsa-miR-320d	CLIP-seq
MIRT1551104	hsa-miR-4429	CLIP-seq
MIRT2036234	hsa-miR-1273e	CLIP-seq
MIRT1127718	hsa-miR-1292	CLIP-seq
MIRT1127719	hsa-miR-141	CLIP-seq
MIRT1127720	hsa-miR-200a	CLIP-seq
MIRT2036235	hsa-miR-3545-3p	CLIP-seq
MIRT1127723	hsa-miR-3682-3p	CLIP-seq
MIRT1127727	hsa-miR-4328	CLIP-seq
MIRT1127728	hsa-miR-4471	CLIP-seq
MIRT1127729	hsa-miR-452	CLIP-seq
MIRT1127731	hsa-miR-4676-3p	CLIP-seq
MIRT1127732	hsa-miR-4677-3p	CLIP-seq
MIRT1127733	hsa-miR-4679	CLIP-seq
MIRT1127734	hsa-miR-483-3p	CLIP-seq
MIRT2036236	hsa-miR-494	CLIP-seq
MIRT2036237	hsa-miR-544	CLIP-seq
MIRT2036234	hsa-miR-1273e	CLIP-seq
MIRT1127718	hsa-miR-1292	CLIP-seq
MIRT1127719	hsa-miR-141	CLIP-seq
MIRT1127720	hsa-miR-200a	CLIP-seq
MIRT2036235	hsa-miR-3545-3p	CLIP-seq
MIRT1127723	hsa-miR-3682-3p	CLIP-seq
MIRT2266535	hsa-miR-369-5p	CLIP-seq
MIRT2266536	hsa-miR-4264	CLIP-seq
MIRT1127727	hsa-miR-4328	CLIP-seq
MIRT1127728	hsa-miR-4471	CLIP-seq
MIRT1127729	hsa-miR-452	CLIP-seq
MIRT1127731	hsa-miR-4676-3p	CLIP-seq
MIRT1127732	hsa-miR-4677-3p	CLIP-seq
MIRT1127733	hsa-miR-4679	CLIP-seq
MIRT2266537	hsa-miR-4695-3p	CLIP-seq
MIRT2266538	hsa-miR-4797-3p	CLIP-seq
MIRT1127734	hsa-miR-483-3p	CLIP-seq
MIRT2036236	hsa-miR-494	CLIP-seq
MIRT2036237	hsa-miR-544	CLIP-seq
MIRT1127718	hsa-miR-1292	CLIP-seq
MIRT1127719	hsa-miR-141	CLIP-seq
MIRT1127720	hsa-miR-200a	CLIP-seq
MIRT2036235	hsa-miR-3545-3p	CLIP-seq
MIRT1127723	hsa-miR-3682-3p	CLIP-seq
MIRT2266535	hsa-miR-369-5p	CLIP-seq
MIRT2266536	hsa-miR-4264	CLIP-seq
MIRT1127728	hsa-miR-4471	CLIP-seq
MIRT1127729	hsa-miR-452	CLIP-seq
MIRT1127731	hsa-miR-4676-3p	CLIP-seq
MIRT1127732	hsa-miR-4677-3p	CLIP-seq
MIRT1127733	hsa-miR-4679	CLIP-seq
MIRT2266537	hsa-miR-4695-3p	CLIP-seq
MIRT2266538	hsa-miR-4797-3p	CLIP-seq
MIRT1127734	hsa-miR-483-3p	CLIP-seq
MIRT1127718	hsa-miR-1292	CLIP-seq
MIRT1127719	hsa-miR-141	CLIP-seq
MIRT1127720	hsa-miR-200a	CLIP-seq
MIRT1127723	hsa-miR-3682-3p	CLIP-seq
MIRT1127728	hsa-miR-4471	CLIP-seq
MIRT1127729	hsa-miR-452	CLIP-seq
MIRT1127731	hsa-miR-4676-3p	CLIP-seq
MIRT1127732	hsa-miR-4677-3p	CLIP-seq
MIRT1127733	hsa-miR-4679	CLIP-seq
MIRT1127734	hsa-miR-483-3p	CLIP-seq
MIRT1127718	hsa-miR-1292	CLIP-seq
MIRT1127719	hsa-miR-141	CLIP-seq
MIRT1127720	hsa-miR-200a	CLIP-seq
MIRT1127723	hsa-miR-3682-3p	CLIP-seq
MIRT1127728	hsa-miR-4471	CLIP-seq
MIRT1127729	hsa-miR-452	CLIP-seq
MIRT1127731	hsa-miR-4676-3p	CLIP-seq
MIRT1127734	hsa-miR-483-3p	CLIP-seq

Show/Hide all (22)

GO ID	Ontology	Definition	Evidence
GO:0000045	Process	Autophagosome assembly	IBA
GO:0000045	Process	Autophagosome assembly	IEA
GO:0000421	Component	Autophagosome membrane	IBA
GO:0000421	Component	Autophagosome membrane	IEA
GO:0000422	Process	Autophagy of mitochondrion	IEA
GO:0000423	Process	Mitophagy	IBA
GO:0005543	Function	Phospholipid binding	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005776	Component	Autophagosome	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005874	Component	Microtubule	IEA
GO:0006914	Process	Autophagy	IEA
GO:0006995	Process	Cellular response to nitrogen starvation	IBA
GO:0008017	Function	Microtubule binding	IBA
GO:0008429	Function	Phosphatidylethanolamine binding	IBA
GO:0012505	Component	Endomembrane system	IEA
GO:0016020	Component	Membrane	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IBA
GO:0031625	Function	Ubiquitin protein ligase binding	IEA
GO:0097352	Process	Autophagosome maturation	IBA
GO:0097352	Process	Autophagosome maturation	IEA

MIM	HGNC	e!Ensembl
620673	34390	ENSG00000258102

A6NCE7

Protein name

Microtubule-associated protein 1 light chain 3 beta 2 (Microtubule-associated proteins 1A/1B light chain 3 beta 2) (Microtubule-associated proteins 1A/1B light chain 3B-like) (MAP1A/MAP1B LC3 B-like) (MAP1A/MAP1B light chain 3 B-like)

Protein function

Ubiquitin-like modifier involved in formation of autophagosomal vacuoles (autophagosomes). Plays a role in mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cel

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02991	Atg8	15 → 120	Autophagy protein Atg8 ubiquitin like	Domain

Sequence

MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNM
SELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVCASQETFG
MKLSV

Sequence length

125

Interactions

View interactions

	KEGG
	Mitophagy - animal Autophagy - animal Ferroptosis Apelin signaling pathway NOD-like receptor signaling pathway Amyotrophic lateral sclerosis Pathways of neurodegeneration - multiple diseases Shigellosis Kaposi sarcoma-associated herpesvirus infection

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CHILDHOOD ACUTE LYMPHOBLASTIC LEUKEMIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC LYMPHOCYTIC LEUKEMIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEARING LOSS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (5)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Double Outlet Right Ventricle	Double outlet right ventricle	Pubtator	23403903	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Learning Disabilities	Learning disorders	Pubtator	23403903	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	GWASDB_DG	20512145		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	GWASDB_DG	19684603		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	GWASCAT_DG	19684603		★★★★★ ★☆☆☆☆ Found in Text Mining only

MAP1LC3B2 (microtubule associated protein 1 light chain 3 beta 2)