FAM163B (family with sequence similarity 163 member B)

Gene

• Entrez ID: 642968
• Gene name: Family with sequence similarity 163 member B
• Gene symbol: FAM163B
• Synonyms (NCBI Gene): C9orf166
• Chromosome: 9
• Chromosome location: 9q34.2

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT981524	hsa-miR-1197	CLIP-seq
MIRT981525	hsa-miR-1224-5p	CLIP-seq
MIRT981526	hsa-miR-125a-5p	CLIP-seq
MIRT981527	hsa-miR-125b	CLIP-seq
MIRT981528	hsa-miR-1321	CLIP-seq
MIRT981529	hsa-miR-1915	CLIP-seq
MIRT981530	hsa-miR-331-3p	CLIP-seq
MIRT981531	hsa-miR-361-3p	CLIP-seq
MIRT981532	hsa-miR-4270	CLIP-seq
MIRT981533	hsa-miR-4319	CLIP-seq
MIRT981534	hsa-miR-4436a	CLIP-seq
MIRT981535	hsa-miR-4441	CLIP-seq
MIRT981536	hsa-miR-4643	CLIP-seq
MIRT981537	hsa-miR-4717-3p	CLIP-seq
MIRT981538	hsa-miR-4728-5p	CLIP-seq
MIRT981539	hsa-miR-4739	CLIP-seq
MIRT981540	hsa-miR-4751	CLIP-seq
MIRT981541	hsa-miR-4756-5p	CLIP-seq
MIRT981542	hsa-miR-4802-3p	CLIP-seq
MIRT981543	hsa-miR-544b	CLIP-seq
MIRT981544	hsa-miR-550a	CLIP-seq
MIRT981545	hsa-miR-642b	CLIP-seq
MIRT1990782	hsa-miR-24	CLIP-seq
MIRT1990783	hsa-miR-3157-5p	CLIP-seq
MIRT1990784	hsa-miR-3614-5p	CLIP-seq
MIRT1990785	hsa-miR-4437	CLIP-seq
MIRT1990786	hsa-miR-4691-3p	CLIP-seq
MIRT1990787	hsa-miR-4721	CLIP-seq
MIRT2225018	hsa-miR-1253	CLIP-seq
MIRT2225019	hsa-miR-125a-3p	CLIP-seq
MIRT2225020	hsa-miR-3154	CLIP-seq
MIRT2225021	hsa-miR-3665	CLIP-seq
MIRT2225022	hsa-miR-3667-3p	CLIP-seq
MIRT2225023	hsa-miR-4468	CLIP-seq
MIRT2225024	hsa-miR-502-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	24550280, 30126976, 32296183
GO:0016020	Component	Membrane	IEA

Other IDs

• MIM: HGNC
• HGNC: N/A
• e!Ensembl: HGNC

Protein

• UniProt ID: P0C2L3
• Protein name: Protein FAM163B
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF15069	FAM163	1 → 166	FAM163 family	Family

• Sequence:

  MTAGTVVITGGILATVILLCIIAVLCYCRLQYYCCKKDESEEDEEEPDFAVHSHLPPLHS
  NRNLVLTNGPALYPTASTSFSQKSPQARALCRSCSHCEPPTFFLQEPPEEEEDVLNGGER
  VLYKSVSQEDVELPPGGFGGLQALNPNRLSAMREAFARSRSISTDV

• Sequence length: 166

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Breast Neoplasms	Breast neoplasm	Pubtator	37761960	Associate	★☆☆☆☆ Found in Text Mining only