Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	6424
Gene name	Secreted frizzled related protein 4
Gene symbol	SFRP4
Synonyms (NCBI Gene)	FRP-4FRPHEFRZB-2PYLsFRP-4
Chromosome	7
Chromosome location	7p14.1
Summary	Secreted frizzled-related protein 4 (SFRP4) is a member of the SFRP family that contains a cysteine-rich domain homologous to the putative Wnt-binding site of Frizzled proteins. SFRPs act as soluble modulators of Wnt signaling. The expression of SFRP4 in

Show/Hide all (3)

SNP ID	Visualize variation	Clinical significance	Consequence
rs755007671	G>A	Pathogenic	Stop gained, coding sequence variant
rs879253778	CTGTACC>-	Pathogenic	Coding sequence variant, frameshift variant
rs879255603	->C	Pathogenic	Coding sequence variant, frameshift variant

152

Show/Hide all (152)

miRTarBase ID	miRNA	Experiments	Reference
MIRT030345	hsa-miR-26b-5p	Microarray	19088304
MIRT733229	hsa-miR-181a-5p	Immunocytochemistry (ICC)Luciferase reporter assayqRT-PCR	33574092
MIRT1341964	hsa-miR-1256	CLIP-seq
MIRT1341965	hsa-miR-1297	CLIP-seq
MIRT1341966	hsa-miR-183	CLIP-seq
MIRT1341967	hsa-miR-203	CLIP-seq
MIRT1341968	hsa-miR-2052	CLIP-seq
MIRT1341969	hsa-miR-26a	CLIP-seq
MIRT1341970	hsa-miR-26b	CLIP-seq
MIRT1341971	hsa-miR-3676	CLIP-seq
MIRT1341972	hsa-miR-3907	CLIP-seq
MIRT1341973	hsa-miR-4299	CLIP-seq
MIRT1341974	hsa-miR-4456	CLIP-seq
MIRT1341975	hsa-miR-4465	CLIP-seq
MIRT1341976	hsa-miR-4720-3p	CLIP-seq
MIRT1341977	hsa-miR-4804-3p	CLIP-seq
MIRT1341978	hsa-miR-548q	CLIP-seq
MIRT1341979	hsa-miR-609	CLIP-seq
MIRT2101214	hsa-miR-1303	CLIP-seq
MIRT2101215	hsa-miR-4795-3p	CLIP-seq
MIRT1341964	hsa-miR-1256	CLIP-seq
MIRT1341966	hsa-miR-183	CLIP-seq
MIRT1341967	hsa-miR-203	CLIP-seq
MIRT1341968	hsa-miR-2052	CLIP-seq
MIRT1341971	hsa-miR-3676	CLIP-seq
MIRT2325594	hsa-miR-4717-3p	CLIP-seq
MIRT2459205	hsa-miR-1231	CLIP-seq
MIRT2459206	hsa-miR-219-1-3p	CLIP-seq
MIRT2459207	hsa-miR-3174	CLIP-seq
MIRT2459208	hsa-miR-346	CLIP-seq
MIRT2459209	hsa-miR-4288	CLIP-seq
MIRT2459210	hsa-miR-4418	CLIP-seq
MIRT2459211	hsa-miR-4709-3p	CLIP-seq
MIRT2459212	hsa-miR-509-3-5p	CLIP-seq
MIRT2459213	hsa-miR-509-5p	CLIP-seq
MIRT2459214	hsa-miR-571	CLIP-seq
MIRT2459215	hsa-miR-632	CLIP-seq
MIRT2459205	hsa-miR-1231	CLIP-seq
MIRT2459208	hsa-miR-346	CLIP-seq
MIRT2459209	hsa-miR-4288	CLIP-seq
MIRT2459215	hsa-miR-632	CLIP-seq
MIRT2621308	hsa-miR-103b	CLIP-seq
MIRT2621309	hsa-miR-1183	CLIP-seq
MIRT1341964	hsa-miR-1256	CLIP-seq
MIRT2621310	hsa-miR-1258	CLIP-seq
MIRT2621311	hsa-miR-1296	CLIP-seq
MIRT1341966	hsa-miR-183	CLIP-seq
MIRT2621312	hsa-miR-1915	CLIP-seq
MIRT2621313	hsa-miR-194	CLIP-seq
MIRT1341967	hsa-miR-203	CLIP-seq
MIRT1341968	hsa-miR-2052	CLIP-seq
MIRT2459206	hsa-miR-219-1-3p	CLIP-seq
MIRT2621314	hsa-miR-219-2-3p	CLIP-seq
MIRT2621315	hsa-miR-2276	CLIP-seq
MIRT2621316	hsa-miR-2909	CLIP-seq
MIRT2621317	hsa-miR-3129-3p	CLIP-seq
MIRT2621318	hsa-miR-3143	CLIP-seq
MIRT2621319	hsa-miR-3162-3p	CLIP-seq
MIRT2621320	hsa-miR-3163	CLIP-seq
MIRT2459207	hsa-miR-3174	CLIP-seq
MIRT2621321	hsa-miR-3183	CLIP-seq
MIRT2621322	hsa-miR-3607-3p	CLIP-seq
MIRT2621323	hsa-miR-3614-3p	CLIP-seq
MIRT2621324	hsa-miR-3653	CLIP-seq
MIRT2621325	hsa-miR-3658	CLIP-seq
MIRT1341971	hsa-miR-3676	CLIP-seq
MIRT2621326	hsa-miR-376c	CLIP-seq
MIRT2621327	hsa-miR-3929	CLIP-seq
MIRT2621328	hsa-miR-4265	CLIP-seq
MIRT2621329	hsa-miR-4296	CLIP-seq
MIRT2621330	hsa-miR-4322	CLIP-seq
MIRT2459210	hsa-miR-4418	CLIP-seq
MIRT2621331	hsa-miR-4419b	CLIP-seq
MIRT2621332	hsa-miR-4436b-3p	CLIP-seq
MIRT2621333	hsa-miR-4446-5p	CLIP-seq
MIRT2621334	hsa-miR-4478	CLIP-seq
MIRT2621335	hsa-miR-4645-5p	CLIP-seq
MIRT2621336	hsa-miR-4662a-5p	CLIP-seq
MIRT2621337	hsa-miR-4673	CLIP-seq
MIRT2621338	hsa-miR-4688	CLIP-seq
MIRT2621339	hsa-miR-4696	CLIP-seq
MIRT2459211	hsa-miR-4709-3p	CLIP-seq
MIRT2621340	hsa-miR-4711-3p	CLIP-seq
MIRT2325594	hsa-miR-4717-3p	CLIP-seq
MIRT2621341	hsa-miR-4723-3p	CLIP-seq
MIRT2621342	hsa-miR-4726-3p	CLIP-seq
MIRT2621343	hsa-miR-4729	CLIP-seq
MIRT2621344	hsa-miR-4742-5p	CLIP-seq
MIRT2621345	hsa-miR-4755-5p	CLIP-seq
MIRT2621346	hsa-miR-4761-3p	CLIP-seq
MIRT2621347	hsa-miR-4796-5p	CLIP-seq
MIRT2459212	hsa-miR-509-3-5p	CLIP-seq
MIRT2459213	hsa-miR-509-5p	CLIP-seq
MIRT2621348	hsa-miR-543	CLIP-seq
MIRT2621349	hsa-miR-548ag	CLIP-seq
MIRT2621350	hsa-miR-548ai	CLIP-seq
MIRT2621351	hsa-miR-548m	CLIP-seq
MIRT2459214	hsa-miR-571	CLIP-seq
MIRT2621352	hsa-miR-576-3p	CLIP-seq
MIRT2621353	hsa-miR-581	CLIP-seq
MIRT2621354	hsa-miR-875-5p	CLIP-seq
MIRT2621308	hsa-miR-103b	CLIP-seq
MIRT2621309	hsa-miR-1183	CLIP-seq
MIRT1341964	hsa-miR-1256	CLIP-seq
MIRT2621310	hsa-miR-1258	CLIP-seq
MIRT2621311	hsa-miR-1296	CLIP-seq
MIRT1341966	hsa-miR-183	CLIP-seq
MIRT2621312	hsa-miR-1915	CLIP-seq
MIRT2621313	hsa-miR-194	CLIP-seq
MIRT1341967	hsa-miR-203	CLIP-seq
MIRT1341968	hsa-miR-2052	CLIP-seq
MIRT2459206	hsa-miR-219-1-3p	CLIP-seq
MIRT2621314	hsa-miR-219-2-3p	CLIP-seq
MIRT2621315	hsa-miR-2276	CLIP-seq
MIRT2621316	hsa-miR-2909	CLIP-seq
MIRT2621318	hsa-miR-3143	CLIP-seq
MIRT2621319	hsa-miR-3162-3p	CLIP-seq
MIRT2459207	hsa-miR-3174	CLIP-seq
MIRT2621322	hsa-miR-3607-3p	CLIP-seq
MIRT2621323	hsa-miR-3614-3p	CLIP-seq
MIRT2690558	hsa-miR-365	CLIP-seq
MIRT2621324	hsa-miR-3653	CLIP-seq
MIRT2621325	hsa-miR-3658	CLIP-seq
MIRT1341971	hsa-miR-3676	CLIP-seq
MIRT2621326	hsa-miR-376c	CLIP-seq
MIRT2621327	hsa-miR-3929	CLIP-seq
MIRT2459210	hsa-miR-4418	CLIP-seq
MIRT2621331	hsa-miR-4419b	CLIP-seq
MIRT2621332	hsa-miR-4436b-3p	CLIP-seq
MIRT2621333	hsa-miR-4446-5p	CLIP-seq
MIRT2621334	hsa-miR-4478	CLIP-seq
MIRT2621335	hsa-miR-4645-5p	CLIP-seq
MIRT2621337	hsa-miR-4673	CLIP-seq
MIRT2621338	hsa-miR-4688	CLIP-seq
MIRT2621339	hsa-miR-4696	CLIP-seq
MIRT2459211	hsa-miR-4709-3p	CLIP-seq
MIRT2621340	hsa-miR-4711-3p	CLIP-seq
MIRT2325594	hsa-miR-4717-3p	CLIP-seq
MIRT2621342	hsa-miR-4726-3p	CLIP-seq
MIRT2621343	hsa-miR-4729	CLIP-seq
MIRT2621344	hsa-miR-4742-5p	CLIP-seq
MIRT2621345	hsa-miR-4755-5p	CLIP-seq
MIRT2621346	hsa-miR-4761-3p	CLIP-seq
MIRT2621347	hsa-miR-4796-5p	CLIP-seq
MIRT2459212	hsa-miR-509-3-5p	CLIP-seq
MIRT2459213	hsa-miR-509-5p	CLIP-seq
MIRT2621348	hsa-miR-543	CLIP-seq
MIRT2621349	hsa-miR-548ag	CLIP-seq
MIRT2621350	hsa-miR-548ai	CLIP-seq
MIRT2621351	hsa-miR-548m	CLIP-seq
MIRT2459214	hsa-miR-571	CLIP-seq
MIRT2621352	hsa-miR-576-3p	CLIP-seq

Show/Hide all (41)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	18945944
GO:0001501	Process	Skeletal system development	IEA
GO:0002092	Process	Positive regulation of receptor internalization	IDA	16151791
GO:0005515	Function	Protein binding	IPI	15607035, 32296183, 32814053
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	14760084
GO:0005634	Component	Nucleus	IDA	18938133
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	11793365, 14760084, 18938133
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IMP	14760084, 15705870
GO:0009725	Process	Response to hormone	NAS	10211996
GO:0009887	Process	Animal organ morphogenesis	IEA
GO:0009986	Component	Cell surface	IDA	14760084
GO:0010628	Process	Positive regulation of gene expression	IDA	18938133
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0017147	Function	Wnt-protein binding	IBA
GO:0017147	Function	Wnt-protein binding	IDA	17462603
GO:0017147	Function	Wnt-protein binding	IPI	17462603
GO:0017147	Function	Wnt-protein binding	NAS	24431302
GO:0030154	Process	Cell differentiation	IEA
GO:0030178	Process	Negative regulation of Wnt signaling pathway	NAS	24431302
GO:0030510	Process	Regulation of BMP signaling pathway	IEA
GO:0030510	Process	Regulation of BMP signaling pathway	ISS
GO:0035567	Process	Non-canonical Wnt signaling pathway	IBA
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IMP	15705870
GO:0045606	Process	Positive regulation of epidermal cell differentiation	IDA	18938133
GO:0055062	Process	Phosphate ion homeostasis	IDA	12952927, 16151791
GO:0060070	Process	Canonical Wnt signaling pathway	IBA
GO:0060349	Process	Bone morphogenesis	IEA
GO:0060349	Process	Bone morphogenesis	IMP	27355534
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IDA	18945944
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IEA
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IMP	14760084, 15705870
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	IGI	18166153
GO:1902174	Process	Positive regulation of keratinocyte apoptotic process	IDA	18938133
GO:2000051	Process	Negative regulation of non-canonical Wnt signaling pathway	IEA
GO:2000051	Process	Negative regulation of non-canonical Wnt signaling pathway	ISS
GO:2000119	Process	Negative regulation of sodium-dependent phosphate transport	IDA	12952927, 16151791

MIM	HGNC	e!Ensembl
606570	10778	ENSG00000106483

Q6FHJ7

Protein name

Secreted frizzled-related protein 4 (sFRP-4) (Frizzled protein, human endometrium) (FrpHE)

Protein function

Soluble frizzled-related proteins (sFRPS) function as modulators of Wnt signaling through direct interaction with Wnts. They have a role in regulating cell growth and differentiation in specific cell types (By similarity). SFRP4 plays a role in

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01392	Fz	24 → 133	Fz domain	Domain
PF01759	NTR	188 → 289	UNC-6/NTR/C345C module	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in mesenchymal cells. Highly expressed in the stroma of proliferative endometrium. Expressed in cardiomyocytes. Shows moderate to strong expression in ovarian tumors with expression increasing as the tumor stage increases. In

Sequence

MFLSILVALCLWLHLALGVRGAPCEAVRIPMCRHMPWNITRMPNHLHHSTQENAILAIEQ
YEELVDVNCSAVLRFFLCAMYAPICTLEFLHDPIKPCKSVCQRARDDCEPLMKMYNHSWP
ESLACDELPVYDRGVCISPEAIVTDLPEDVKWIDITPDMMVQERPLDVDCKRLSPDRCKC
KKVKPTLATYLSKNYSYVIHAKIKAVQRSGCNEVTTVVDVKEIFKSSSPIPRTQVPLITN
SSCQCPHILPHQDVLIMCYEWRSRMMLLENCLVEKWRDQLSKRSIQWEERLQEQRRTVQD
KKKTAGRTSRSNPPKPKGKPPAPKPASPKKNIKTRSAQKRTNPKRV

Sequence length

346

Interactions

View interactions

	KEGG
	Wnt signaling pathway

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Pyle metaphyseal dysplasia	Pathogenic; Likely pathogenic	rs879255603, rs755007671, rs879253778, rs1344808304, rs758308395	RCV000234979 RCV000234991 RCV000234974 RCV001271113 RCV001271112	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (20)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ARTHRITIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BONE DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BONE FRACTURE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHONDRODYSPLASIA CALCIFICANS METAPHYSEALIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DESBUQUOIS SYNDROME	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, TYPE 2	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DUPUYTREN CONTRACTURE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FRONTOTEMPORAL DEMENTIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLAUCOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, HIP	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOPOROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CYSTS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY ANGLE CLOSURE GLAUCOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SFRP4-related disorder	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TREATMENT-RESISTANT HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (148)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	BEFREE	23039795		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	19730886, 24925057		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Rickets	Rickets	BEFREE	25165185		★★★★★ ★☆☆☆☆ Found in Text Mining only
Androgen Insensitivity Syndrome	Androgen insensitivity syndrome	Pubtator	31671693	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	28977937, 30906634		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	17476687		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	29037197		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	31101982		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	29037197		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	29037197	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	36295481	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	27570179		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	16609023		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	LHGDN	16609023		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	24406045	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10211996		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	22037257, 32990024	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	28637297, 33361638	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	21709441, 26397159	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	20532728	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	33760186	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	26457595, 29749862		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	23326605	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	26394929	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	22363760, 23326605, 29332600		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	38460409	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	24787227		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	24787227		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	24002901		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	16423993, 18765431, 19347729		★★★★★ ★☆☆☆☆ Found in Text Mining only
Class III malocclusion	Malocclusion	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	29037197	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	30473377	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	31435461		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	16356838, 19730886, 20403915		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	CTD_human_DG	17923031		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	16356838		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	17131472, 25107489, 33891491, 38151510	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	CTD_human_DG	17923031		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	17145819, 19562778		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	25820527, 29037197, 31113729		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	25820527, 29037197		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	29037197	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	25820527, 29037197		★★★★★ ★☆☆☆☆ Found in Text Mining only
Corpus Luteum Cyst	Corpus Luteum Cyst	CTD_human_DG	21239663		★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniosynostoses	Craniosynostosis	Pubtator	22028906	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	22028906		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	17195216, 23864140		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	35290144, 40640313	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	23140642, 25820527, 26406932, 29491225, 29721017, 31301214, 31336149, 31583475		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	CTD_human_DG	23140642		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dupuytren Contracture	Dupuytren Contracture	GWASCAT_DG	21732829, 28886342		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dupuytren Contracture	Dupuytren contracture	Pubtator	21732829, 28886342, 34573275	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dupuytren`s Disease	Dupuytren Contracture	GWASDB_DG	21732829		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dystrophia myotonica 2	Myotonic dystrophy	BEFREE	25820527, 31583475		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial Hyperplasia	BEFREE	10211996		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	26397159, 29693365, 32555395	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Stromal Sarcoma	Endometrial Stromal Sarcoma	BEFREE	15307134		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	23326605		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	28637297		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	26715268		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	26715268	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Giant Cell Tumor of Bone	Giant cell tumor of bone	BEFREE	11069730		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	26030909, 30591679		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	26030909, 30591679		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	24406045, 26712519	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	26030909		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	40640313	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Growth Hormone-Secreting Pituitary Adenoma	Somatotroph Adenoma	BEFREE	26935389		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	36295481, 37275875, 37390254	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
hemangiopericytoma	Hemangiopericytoma	BEFREE	19158050		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	35290144	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	25322919	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	Pubtator	23825088	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	28637297	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	20795789	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	18592156, 20532728		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	LHGDN	18592156		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	20849603, 35101137, 37275875	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	32677026	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	24041698, 28534940, 29185158		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	26715268		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	26457595, 29749862		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	22363760, 29332600		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	28977937, 30906634		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	17476687, 22915211, 27570179, 29079735		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10211996, 18542073, 21704588, 21709441, 22363760, 24787227, 28536422, 29079735, 29385093, 31301214, 31516566		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	24787227		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	31435461		★★★★★ ★☆☆☆☆ Found in Text Mining only
Marinesco-Sjogren syndrome	Marinesco-Sjogren Syndrome	BEFREE	15958545		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	22964784		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	15705870, 28534940		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	23093371		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	31113729		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopia, Degenerative	Myopia	GWASCAT_DG	23049088		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15307134, 18542073, 19038436, 19732125, 22363760, 23039795, 24917361, 25107489, 25165185, 25395299, 26030909, 28218291, 28977937, 29277675, 29385093, 30710752 View all (1 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	31336149		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	25322919, 29721017, 31301214		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	25322919	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Oral Submucous Fibrosis	Oral Submucous Fibrosis	BEFREE	25872484		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	24894724, 37390254	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoarthritis of hip	Osteoarthritis Of Hip	BEFREE	17195216		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteomalacia	Osteomalacia	BEFREE	25165185		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	20613673, 24662300		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	29332600		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Cysts	Ovarian Cysts	CTD_human_DG	21239663		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ovarian neoplasm	Ovarian neoplasm	BEFREE	22363760		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	22363760, 23039795	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	23326605	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	28977937, 30906634		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	30906634		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	18528941		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papilloma, Squamous Cell	Papilloma	BEFREE	27696538		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parathyroid Neoplasms	Parathyroid Neoplasms	BEFREE	21638518		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parathyroid Neoplasms	Parathyroid neoplasm	Pubtator	21638518	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Phosphate Diabetes	Phosphate Diabetes	BEFREE	12952927		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary Neoplasms	LHGDN	18079202		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Autosomal Dominant	Polycystic kidney disease	Pubtator	30403162	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	LHGDN	18945944		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	28403963, 31486991		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary angle-closure glaucoma	Angle closure glaucoma	GWASCAT_DG	27064256		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	17476687, 22915211, 27570179, 29079735		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	17476687		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	22915211, 29079735, 32677026, 33361638, 36124532, 39511287	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	25825452		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	30586565		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pyle disease	Pyle Disease	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Pyle metaphyseal dysplasia	Pyle Metaphyseal Dysplasia	GENOMICS_ENGLAND_DG	22387305, 28100910		★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Pyle metaphyseal dysplasia	Pyle Metaphyseal Dysplasia	BEFREE	27355534, 28100910, 31239337		★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Pyle metaphyseal dysplasia	Pyle Metaphyseal Dysplasia	ORPHANET_DG	27355534		★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Pyle metaphyseal dysplasia	Pyle Metaphyseal Dysplasia	HPO_DG			★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Pyle metaphyseal dysplasia	Pyle Metaphyseal Dysplasia	CTD_human_DG			★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Pyle metaphyseal dysplasia	Pyle Metaphyseal Dysplasia	CLINVAR_DG			★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	17145819, 19562778		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	25194984		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	15307134		★★★★★ ★☆☆☆☆ Found in Text Mining only
Scleroderma Localized	Scleroderma	Pubtator	37372943	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Scoliosis, unspecified	Scoliosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	32219160	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	19038436		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	25104726		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	18158559, 28152305, 33277667	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	17943183		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	39984992	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	24577895	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	19513747, 32527205, 39346086, 39372720	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Diseases	Uterine polyp	Pubtator	21709441	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	28637297		★★★★★ ★☆☆☆☆ Found in Text Mining only

SFRP4 (secreted frizzled related protein 4)