Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	6423
Gene name	Secreted frizzled related protein 2
Gene symbol	SFRP2
Synonyms (NCBI Gene)	FRP-2SARP1SDF-5
Chromosome	4
Chromosome location	4q31.3
Summary	This gene encodes a member of the SFRP family that contains a cysteine-rich domain homologous to the putative Wnt-binding site of Frizzled proteins. SFRPs act as soluble modulators of Wnt signaling. Methylation of this gene is a potential marker for the p

128

Show/Hide all (128)

miRTarBase ID	miRNA	Experiments	Reference
MIRT003607	hsa-miR-29a-3p	Luciferase reporter assayqRT-PCRWestern blot	20551325
MIRT006749	hsa-miR-218-5p	Luciferase reporter assay	21501592
MIRT006749	hsa-miR-218-5p	Luciferase reporter assay	21501592
MIRT006749	hsa-miR-218-5p	Luciferase reporter assay	21501592
MIRT006749	hsa-miR-218-5p	Luciferase reporter assay	23060446
MIRT006749	hsa-miR-218-5p	Luciferase reporter assayqRT-PCRWestern blot	24091133
MIRT006749	hsa-miR-218-5p	ELISAImmunohistochemistryLuciferase reporter assayqRT-PCR	27738322
MIRT006749	hsa-miR-218-5p	ELISAImmunohistochemistryLuciferase reporter assayqRT-PCR	27738322
MIRT734051	hsa-miR-22-3p	ImmunofluorescenceLuciferase reporter assayqRT-PCRWestern blotting	31891366
MIRT1341933	hsa-miR-1	CLIP-seq
MIRT1341934	hsa-miR-106a	CLIP-seq
MIRT1341935	hsa-miR-106b	CLIP-seq
MIRT1341936	hsa-miR-17	CLIP-seq
MIRT1341937	hsa-miR-206	CLIP-seq
MIRT1341938	hsa-miR-20a	CLIP-seq
MIRT1341939	hsa-miR-20b	CLIP-seq
MIRT1341940	hsa-miR-3200-5p	CLIP-seq
MIRT1341941	hsa-miR-3609	CLIP-seq
MIRT1341942	hsa-miR-3673	CLIP-seq
MIRT1341943	hsa-miR-3689a-5p	CLIP-seq
MIRT1341944	hsa-miR-3689b	CLIP-seq
MIRT1341945	hsa-miR-3689e	CLIP-seq
MIRT1341946	hsa-miR-3689f	CLIP-seq
MIRT1341947	hsa-miR-409-3p	CLIP-seq
MIRT1341948	hsa-miR-4264	CLIP-seq
MIRT1341949	hsa-miR-4432	CLIP-seq
MIRT1341950	hsa-miR-4666-5p	CLIP-seq
MIRT1341951	hsa-miR-4699-3p	CLIP-seq
MIRT1341952	hsa-miR-4766-5p	CLIP-seq
MIRT1341953	hsa-miR-4796-3p	CLIP-seq
MIRT1341954	hsa-miR-4797-3p	CLIP-seq
MIRT1341955	hsa-miR-499-5p	CLIP-seq
MIRT1341956	hsa-miR-519d	CLIP-seq
MIRT1341957	hsa-miR-548ah	CLIP-seq
MIRT1341958	hsa-miR-582-5p	CLIP-seq
MIRT1341959	hsa-miR-610	CLIP-seq
MIRT1341960	hsa-miR-613	CLIP-seq
MIRT1341961	hsa-miR-627	CLIP-seq
MIRT1341962	hsa-miR-924	CLIP-seq
MIRT1341963	hsa-miR-93	CLIP-seq
MIRT2101211	hsa-miR-548ag	CLIP-seq
MIRT2101212	hsa-miR-548ai	CLIP-seq
MIRT2101213	hsa-miR-548m	CLIP-seq
MIRT2621273	hsa-miR-1203	CLIP-seq
MIRT2621274	hsa-miR-122	CLIP-seq
MIRT2621275	hsa-miR-128	CLIP-seq
MIRT2621276	hsa-miR-1292	CLIP-seq
MIRT2621277	hsa-miR-1323	CLIP-seq
MIRT2621278	hsa-miR-2110	CLIP-seq
MIRT2621279	hsa-miR-218	CLIP-seq
MIRT2621280	hsa-miR-224	CLIP-seq
MIRT2621281	hsa-miR-27a	CLIP-seq
MIRT2621282	hsa-miR-27b	CLIP-seq
MIRT2621283	hsa-miR-3065-5p	CLIP-seq
MIRT2621284	hsa-miR-3150a-3p	CLIP-seq
MIRT2621285	hsa-miR-3160-3p	CLIP-seq
MIRT2621286	hsa-miR-3194-3p	CLIP-seq
MIRT2621287	hsa-miR-3672	CLIP-seq
MIRT2621288	hsa-miR-3691-3p	CLIP-seq
MIRT2621289	hsa-miR-371b-5p	CLIP-seq
MIRT2621290	hsa-miR-4271	CLIP-seq
MIRT2621291	hsa-miR-4272	CLIP-seq
MIRT2621292	hsa-miR-4300	CLIP-seq
MIRT2621293	hsa-miR-4463	CLIP-seq
MIRT2621294	hsa-miR-4468	CLIP-seq
MIRT2621295	hsa-miR-4650-5p	CLIP-seq
MIRT2621296	hsa-miR-4690-5p	CLIP-seq
MIRT2621297	hsa-miR-4725-3p	CLIP-seq
MIRT2621298	hsa-miR-495	CLIP-seq
MIRT2621299	hsa-miR-516b	CLIP-seq
MIRT2621300	hsa-miR-522	CLIP-seq
MIRT2621301	hsa-miR-548o	CLIP-seq
MIRT2621302	hsa-miR-574-5p	CLIP-seq
MIRT2621303	hsa-miR-636	CLIP-seq
MIRT2621304	hsa-miR-646	CLIP-seq
MIRT2621305	hsa-miR-648	CLIP-seq
MIRT2621306	hsa-miR-888	CLIP-seq
MIRT2621307	hsa-miR-920	CLIP-seq
MIRT1341934	hsa-miR-106a	CLIP-seq
MIRT1341935	hsa-miR-106b	CLIP-seq
MIRT2621273	hsa-miR-1203	CLIP-seq
MIRT2621274	hsa-miR-122	CLIP-seq
MIRT2621275	hsa-miR-128	CLIP-seq
MIRT2621276	hsa-miR-1292	CLIP-seq
MIRT2621277	hsa-miR-1323	CLIP-seq
MIRT1341936	hsa-miR-17	CLIP-seq
MIRT1341938	hsa-miR-20a	CLIP-seq
MIRT1341939	hsa-miR-20b	CLIP-seq
MIRT2621278	hsa-miR-2110	CLIP-seq
MIRT2621279	hsa-miR-218	CLIP-seq
MIRT2621280	hsa-miR-224	CLIP-seq
MIRT2621281	hsa-miR-27a	CLIP-seq
MIRT2621282	hsa-miR-27b	CLIP-seq
MIRT2621283	hsa-miR-3065-5p	CLIP-seq
MIRT2621284	hsa-miR-3150a-3p	CLIP-seq
MIRT2621285	hsa-miR-3160-3p	CLIP-seq
MIRT2621286	hsa-miR-3194-3p	CLIP-seq
MIRT1341941	hsa-miR-3609	CLIP-seq
MIRT2621287	hsa-miR-3672	CLIP-seq
MIRT2621288	hsa-miR-3691-3p	CLIP-seq
MIRT2621289	hsa-miR-371b-5p	CLIP-seq
MIRT2621290	hsa-miR-4271	CLIP-seq
MIRT2621291	hsa-miR-4272	CLIP-seq
MIRT2621292	hsa-miR-4300	CLIP-seq
MIRT2690554	hsa-miR-433	CLIP-seq
MIRT2621293	hsa-miR-4463	CLIP-seq
MIRT2621294	hsa-miR-4468	CLIP-seq
MIRT2621295	hsa-miR-4650-5p	CLIP-seq
MIRT2690555	hsa-miR-4661-5p	CLIP-seq
MIRT2621296	hsa-miR-4690-5p	CLIP-seq
MIRT2621297	hsa-miR-4725-3p	CLIP-seq
MIRT1341953	hsa-miR-4796-3p	CLIP-seq
MIRT2621298	hsa-miR-495	CLIP-seq
MIRT2621299	hsa-miR-516b	CLIP-seq
MIRT1341956	hsa-miR-519d	CLIP-seq
MIRT2621300	hsa-miR-522	CLIP-seq
MIRT1341957	hsa-miR-548ah	CLIP-seq
MIRT2690556	hsa-miR-548c-3p	CLIP-seq
MIRT2621301	hsa-miR-548o	CLIP-seq
MIRT2621302	hsa-miR-574-5p	CLIP-seq
MIRT1341959	hsa-miR-610	CLIP-seq
MIRT2621303	hsa-miR-636	CLIP-seq
MIRT2621304	hsa-miR-646	CLIP-seq
MIRT2621305	hsa-miR-648	CLIP-seq
MIRT2690557	hsa-miR-664	CLIP-seq
MIRT2621306	hsa-miR-888	CLIP-seq
MIRT2621307	hsa-miR-920	CLIP-seq
MIRT1341963	hsa-miR-93	CLIP-seq

101

Show/Hide all (101)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001558	Process	Regulation of cell growth	IEA
GO:0001569	Process	Branching involved in blood vessel morphogenesis	IEA
GO:0001569	Process	Branching involved in blood vessel morphogenesis	ISS
GO:0001756	Process	Somitogenesis	IEA
GO:0001843	Process	Neural tube closure	IEA
GO:0001968	Function	Fibronectin binding	ISS
GO:0002063	Process	Chondrocyte development	IEA
GO:0003151	Process	Outflow tract morphogenesis	IMP	19593212
GO:0003214	Process	Cardiac left ventricle morphogenesis	IMP	19593212
GO:0005178	Function	Integrin binding	ISS
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	10980594
GO:0005615	Component	Extracellular space	IEA
GO:0005615	Component	Extracellular space	ISS
GO:0006915	Process	Apoptotic process	IEA
GO:0007267	Process	Cell-cell signaling	ISS
GO:0007501	Process	Mesodermal cell fate specification	IEA
GO:0007584	Process	Response to nutrient	IEA
GO:0008047	Function	Enzyme activator activity	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	10980594
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IDA	20208569
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IMP	17848950
GO:0008584	Process	Male gonad development	IEA
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0009952	Process	Anterior/posterior pattern specification	IEA
GO:0010629	Process	Negative regulation of gene expression	IEA
GO:0010629	Process	Negative regulation of gene expression	ISS	10980594
GO:0010659	Process	Cardiac muscle cell apoptotic process	IEA
GO:0010667	Process	Negative regulation of cardiac muscle cell apoptotic process	IEA
GO:0010719	Process	Negative regulation of epithelial to mesenchymal transition	IDA	19095296
GO:0010975	Process	Regulation of neuron projection development	IEA
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0017147	Function	Wnt-protein binding	IBA
GO:0017147	Function	Wnt-protein binding	IEA
GO:0017147	Function	Wnt-protein binding	NAS	24431302
GO:0021915	Process	Neural tube development	IEA
GO:0030111	Process	Regulation of Wnt signaling pathway	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0030178	Process	Negative regulation of Wnt signaling pathway	IDA	20208569
GO:0030178	Process	Negative regulation of Wnt signaling pathway	IEA
GO:0030178	Process	Negative regulation of Wnt signaling pathway	NAS	24431302
GO:0030199	Process	Collagen fibril organization	IEA
GO:0030307	Process	Positive regulation of cell growth	IEA
GO:0030307	Process	Positive regulation of cell growth	ISS	10980594
GO:0030308	Process	Negative regulation of cell growth	IDA	20208569
GO:0030336	Process	Negative regulation of cell migration	IEA
GO:0030336	Process	Negative regulation of cell migration	ISS	10980594
GO:0030509	Process	BMP signaling pathway	IEA
GO:0030514	Process	Negative regulation of BMP signaling pathway	IEA
GO:0031012	Component	Extracellular matrix	ISS
GO:0033630	Process	Positive regulation of cell adhesion mediated by integrin	ISS
GO:0035567	Process	Non-canonical Wnt signaling pathway	IBA
GO:0036342	Process	Post-anal tail morphogenesis	IEA
GO:0042127	Process	Regulation of cell population proliferation	IEA
GO:0042662	Process	Negative regulation of mesodermal cell fate specification	IEA
GO:0042733	Process	Embryonic digit morphogenesis	IEA
GO:0042981	Process	Regulation of apoptotic process	IEA
GO:0042981	Process	Regulation of apoptotic process	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IMP	17848950
GO:0045600	Process	Positive regulation of fat cell differentiation	IDA	12055200
GO:0045669	Process	Positive regulation of osteoblast differentiation	IEA
GO:0045766	Process	Positive regulation of angiogenesis	IEA
GO:0045766	Process	Positive regulation of angiogenesis	ISS
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	19095296
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0046546	Process	Development of primary male sexual characteristics	IEA
GO:0048018	Function	Receptor ligand activity	IEA
GO:0048018	Function	Receptor ligand activity	ISS
GO:0048546	Process	Digestive tract morphogenesis	IEA
GO:0048866	Process	Stem cell fate specification	IEA
GO:0050680	Process	Negative regulation of epithelial cell proliferation	IDA	19095296
GO:0050732	Process	Negative regulation of peptidyl-tyrosine phosphorylation	ISS	10980594
GO:0051216	Process	Cartilage development	IEA
GO:0060028	Process	Convergent extension involved in axis elongation	IEA
GO:0060070	Process	Canonical Wnt signaling pathway	IBA
GO:0060070	Process	Canonical Wnt signaling pathway	IEA
GO:0060070	Process	Canonical Wnt signaling pathway	ISS
GO:0061056	Process	Sclerotome development	IEA
GO:0061056	Process	Sclerotome development	ISS
GO:0061133	Function	Endopeptidase activator activity	IEA
GO:0061185	Process	Negative regulation of dermatome development	IEA
GO:0061185	Process	Negative regulation of dermatome development	ISS
GO:0071425	Process	Hematopoietic stem cell proliferation	IEA
GO:0071425	Process	Hematopoietic stem cell proliferation	ISS
GO:0071481	Process	Cellular response to X-ray	IEA
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IDA	17471511
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IEA
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IEA
GO:0090175	Process	Regulation of establishment of planar polarity	IEA
GO:0090244	Process	Wnt signaling pathway involved in somitogenesis	IEA
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	IEA
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	ISS
GO:1902042	Process	Negative regulation of extrinsic apoptotic signaling pathway via death domain receptors	IEA
GO:1902230	Process	Negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage	ISS
GO:1904956	Process	Regulation of midbrain dopaminergic neuron differentiation	IEA
GO:2000035	Process	Regulation of stem cell division	IEA
GO:2000035	Process	Regulation of stem cell division	ISS

MIM	HGNC	e!Ensembl
604157	10777	ENSG00000145423

Q96HF1

Protein name

Secreted frizzled-related protein 2 (FRP-2) (sFRP-2) (Secreted apoptosis-related protein 1) (SARP-1)

Protein function

Soluble frizzled-related proteins (sFRPS) function as modulators of Wnt signaling through direct interaction with Wnts. They have a role in regulating cell growth and differentiation in specific cell types. SFRP2 may be important for eye retinal

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01392	Fz	40 → 150	Fz domain	Domain
PF01759	NTR	187 → 285	UNC-6/NTR/C345C module	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in adipose tissue, heart, brain, skeletal muscle, pancreas, thymus, prostate, testis, ovary, small intestine and colon. Highest levels in adipose tissue, small intestine and colon. {ECO:0000269|PubMed:9391078, ECO:0000269|Pub

Sequence

MLQGPGSLLLLFLASHCCLGSARGLFLFGQPDFSYKRSNCKPIPANLQLCHGIEYQNMRL
PNLLGHETMKEVLEQAGAWIPLVMKQCHPDTKKFLCSLFAPVCLDDLDETIQPCHSLCVQ
VKDRCAPVMSAFGFPWPDMLECDRFPQDNDLCIPLASSDHLLPATEEAPKVCEACKNKND
DDNDIMETLCKNDFALKIKVKEITYINRDTKIILETKSKTIYKLNGVSERDLKKSVLWLK
DSLQCTCEEMNDINAPYLVMGQKQGGELVITSVKRWQKGQREFKRISRSIRKLQC

Sequence length

295

Interactions

View interactions

	KEGG
	Wnt signaling pathway

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (13)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Anophthalmia-microphthalmia syndrome	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ECZEMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, RENAL CELL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DUPUYTREN CONTRACTURE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENOUS THROMBOEMBOLISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (154)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
ACTH-Secreting Pituitary Adenoma	Pituitary adenoma	BEFREE	29620167		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	17947472		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	17131472, 17639423, 18203283, 25053594, 25432628, 25759530, 26258809, 29620167, 30578081, 31456088		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	LHGDN	17639423		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	25320544		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	29391809		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenomatous Polyps	Adenomatous Polyposis	BEFREE	21068132		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	20208569		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	26482433	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis, Gouty	Gouty arthritis	BEFREE	31281508		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	32647207	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	16407829		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	22915211		★★★★★ ★☆☆☆☆ Found in Text Mining only
Biliary Tract Cancer	Biliary Tract Cancer	BEFREE	24002901		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	16609023		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	LHGDN	16609023		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	BEFREE	29704505		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	BEFREE	22082361		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	18283316, 18990230, 19513569, 21673995, 22026417, 30944668, 31515721		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	18283316		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	18283316, 18403594, 18990230, 19513569, 22026417	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	22655072	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	32990024	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinogenesis	Carcinogenesis	Pubtator	19700653, 21709441	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	18990230		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	17273163	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	21709441	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	24947038, 26960688	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	23975733	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	26394929	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	37999144	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	19095296		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	19095296		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	20208569		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chloasma	Melasma	BEFREE	26763443		★★★★★ ★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	30396168		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chromophobe Renal Cell Carcinoma	Chromophobe Carcinoma	CTD_human_DG	18404682		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	18765431, 19347729		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	31430541		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	18716850		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	18716850, 30473377	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Collecting Duct Carcinoma of the Kidney	Renal Carcinoma	CTD_human_DG	18404682		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	15094274, 17352030, 17410438, 17639423, 18203283, 24852431, 24876755, 25053594, 25320544, 25759530, 25773792, 26258809, 26482433, 27114416, 27221916 View all (10 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	CTD_human_DG	17923031, 18716850		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	15094274, 17352030, 17639423, 18795670		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	17131472, 17352030, 18203283, 19700653, 20686305, 21123457, 21709714, 22703586, 24852431, 24876755, 25107489, 25759530, 25991403, 26291085, 26482433 View all (21 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	CTD_human_DG	17923031, 18716850		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms Hereditary Nonpolyposis	Lynch syndrome	Pubtator	25625843	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	17145819, 18404682, 23975733		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	18404682		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	11562759		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	14687710, 16735027		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	29949535, 36991319	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	29462326		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	29462326, 36991319	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	31578133	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	21734802	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	31578133	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal Neoplasms	BEFREE	19700653		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	19700653	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gingival Recession	Gingival Recession	BEFREE	31469431		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	23512659		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	32647207, 34021259	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	23512659		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	10980594		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	26337424, 38225203	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	BEFREE	28333964, 31515721		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	24386373, 24947038	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperaldosteronism	Hyperaldosteronism	BEFREE	24087794		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	19593212	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophy Left Ventricular	Left ventricular disease	Pubtator	19593212	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	18716850, 25773792		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	CTD_human_DG	18716850		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	18716850	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	32517740	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	Pubtator	23825088	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	20795789, 25197341, 25734857	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	34083850	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	18537968, 20795789, 25197341, 26517501		★★★★★ ★☆☆☆☆ Found in Text Mining only
Li-Fraumeni Syndrome	Li-Fraumeni Syndrome	BEFREE	30385632		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	25487617		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	18592156, 24947038, 26960688, 30954576		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	18592156, 24947038		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	24386373, 24947038	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	LHGDN	18592156		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	26323494	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative syndrome	Pubtator	22175903	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	18283316, 18990230, 19513569, 21673995, 22026417, 29391809, 30944668, 31515721		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	18283316		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	20501806		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	22915211, 28645312		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	17297461, 17848950		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	17848950, 18990230, 20795789, 26517501, 28273499, 28851501, 30396168, 30944668		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	19095296		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	18283316		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	18283316, 19458075		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	18283316		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	18283316		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	20208569		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	27042933, 27261482		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	29386699	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	9642118		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	25487617	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	16030194, 22082361		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	29704505		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	30171847		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	30075814		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	30075814	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Neoplasms	Nasopharyngeal carcinoma	Pubtator	10929762	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	16342918, 17947472, 18056424, 18716850, 18990230, 19038436, 19513747, 20208569, 20824703, 20886110, 22136354, 22363119, 22915211, 23512659, 23975733 View all (13 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	30291843		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	17947472, 28422739, 29320940, 31257495		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	9642118		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteosarcoma	Osteosarcoma	BEFREE	26628297, 27821163, 30385632		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	26628297	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	19095296		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	25625843, 32977853, 35741755, 37284741, 38069266	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	18528941		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	31399111		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	27891190	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary Renal Cell Carcinoma	Papillary Renal Carcinoma	CTD_human_DG	18404682		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parathyroid Neoplasms	Parathyroid neoplasm	Pubtator	21638518	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary Neoplasms	LHGDN	18079202		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pleural Diseases	Pleural diseases	Pubtator	37999144	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyp of large intestine	Polyp Of Large Intestine	BEFREE	17639423		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	22915211, 28645312		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	22915211	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasia	Prostatic intraepithelial neoplasia	Pubtator	22915211	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	22175903, 22915211, 36552843	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	21490961	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rectal polyp	Rectal Polyp	BEFREE	24764585		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	20501806		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	17145819, 18404682, 23975733		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	LHGDN	18404682		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	18404682		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis Pigmentosa	BEFREE	10798643, 11192610		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	20069066	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	14687710		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	31515721		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcomatoid Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	18404682		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spherocytosis Type 1	Spherocytosis	Pubtator	37922232	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	18497987		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	19038436		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	22363119, 31578133		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	29790687, 29900911	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	17297461, 17848950		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	19700653, 23942619, 28152305, 32379490, 33107235, 36578802	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	30614796	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	Pubtator	20976176	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	30053090, 31515721		★★★★★ ★☆☆☆☆ Found in Text Mining only
Turcot syndrome	Turcot syndrome	Pubtator	30578081	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	11562759, 17410438		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	19513747, 23226515	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Diseases	Uterine polyp	Pubtator	21709441	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

SFRP2 (secreted frizzled related protein 2)