Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	6422
Gene name	Secreted frizzled related protein 1
Gene symbol	SFRP1
Synonyms (NCBI Gene)	FRPFRP-1FRP1FrzASARP2
Chromosome	8
Chromosome location	8p11.21
Summary	This gene encodes a member of the SFRP family that contains a cysteine-rich domain homologous to the putative Wnt-binding site of Frizzled proteins. Members of this family act as soluble modulators of Wnt signaling; epigenetic silencing of SFRP genes lead

449

Show/Hide all (449)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017159	hsa-miR-335-5p	Microarray	18185580
MIRT052899	hsa-miR-1260b	Luciferase reporter assayqRT-PCRWestern blot	23591200
MIRT052899	hsa-miR-1260b	Luciferase reporter assayqRT-PCRWestern blot	23591200
MIRT438354	hsa-miR-206	FlowqRT-PCR	24855559
MIRT438280	hsa-miR-127-3p	Luciferase reporter assayqRT-PCRWestern blot	24517116
MIRT438280	hsa-miR-127-3p	Luciferase reporter assayqRT-PCRWestern blot	24517116
MIRT052899	hsa-miR-1260b	Luciferase reporter assayWestern blot	24504368
MIRT438354	hsa-miR-206	FlowqRT-PCR	24855559
MIRT438280	hsa-miR-127-3p	Luciferase reporter assayqRT-PCRWestern blot	24517116
MIRT438280	hsa-miR-127-3p	Luciferase reporter assayqRT-PCRWestern blot	24517116
MIRT052899	hsa-miR-1260b	Luciferase reporter assayWestern blot	24504368
MIRT448052	hsa-miR-504-5p	PAR-CLIP	22100165
MIRT448051	hsa-miR-10a-5p	PAR-CLIP	22100165
MIRT448050	hsa-miR-10b-5p	PAR-CLIP	22100165
MIRT448049	hsa-miR-4292	PAR-CLIP	22100165
MIRT448047	hsa-miR-6791-5p	PAR-CLIP	22100165
MIRT448048	hsa-miR-6852-5p	PAR-CLIP	22100165
MIRT448046	hsa-miR-4667-5p	PAR-CLIP	22100165
MIRT448045	hsa-miR-4700-5p	PAR-CLIP	22100165
MIRT448044	hsa-miR-8089	PAR-CLIP	22100165
MIRT448043	hsa-miR-146a-5p	PAR-CLIP	22100165
MIRT448042	hsa-miR-146b-5p	PAR-CLIP	22100165
MIRT448041	hsa-miR-7153-5p	PAR-CLIP	22100165
MIRT448040	hsa-miR-6878-5p	PAR-CLIP	22100165
MIRT448039	hsa-miR-3175	PAR-CLIP	22100165
MIRT448038	hsa-miR-1343-5p	PAR-CLIP	22100165
MIRT448037	hsa-miR-939-5p	PAR-CLIP	22100165
MIRT448035	hsa-miR-6825-5p	PAR-CLIP	22100165
MIRT448036	hsa-miR-3150a-3p	PAR-CLIP	22100165
MIRT448034	hsa-miR-6763-5p	PAR-CLIP	22100165
MIRT737507	hsa-miR-27a-3p	Luciferase reporter assayqRT-PCRWestern blot	28099945
MIRT737507	hsa-miR-27a-3p	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	28401000
MIRT737507	hsa-miR-27a-3p	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	28401000
MIRT438354	hsa-miR-206	Luciferase reporter assayqRT-PCR	27043663
MIRT438354	hsa-miR-206	Luciferase reporter assayqRT-PCR	27043663
MIRT438354	hsa-miR-206	Luciferase reporter assayqRT-PCR	27043663
MIRT438354	hsa-miR-206	Luciferase reporter assayqRT-PCR	27043663
MIRT438354	hsa-miR-206	Luciferase reporter assayqRT-PCR	27043663
MIRT438354	hsa-miR-206	Luciferase reporter assayqRT-PCR	27043663
MIRT438354	hsa-miR-206	Luciferase reporter assayqRT-PCR	27043663
MIRT438354	hsa-miR-206	Luciferase reporter assayqRT-PCR	27043663
MIRT735991	hsa-miR-196a-3p	Luciferase reporter assayWestern blottingMicroarrayqRT-PCR	31609675
MIRT737507	hsa-miR-27a-3p	Luciferase reporter assayWestern blottingImmunohistochemistry (IHC)ImmunofluorescenceqRT-PCR	32484208
MIRT737564	Sja-miR-1	Luciferase reporter assayWestern blottingqRT-PCR	32232014
MIRT448052	hsa-miR-504-5p	PAR-CLIP	22100165
MIRT448051	hsa-miR-10a-5p	PAR-CLIP	22100165
MIRT448050	hsa-miR-10b-5p	PAR-CLIP	22100165
MIRT448049	hsa-miR-4292	PAR-CLIP	22100165
MIRT448047	hsa-miR-6791-5p	PAR-CLIP	22100165
MIRT448048	hsa-miR-6852-5p	PAR-CLIP	22100165
MIRT448046	hsa-miR-4667-5p	PAR-CLIP	22100165
MIRT448045	hsa-miR-4700-5p	PAR-CLIP	22100165
MIRT448044	hsa-miR-8089	PAR-CLIP	22100165
MIRT448043	hsa-miR-146a-5p	PAR-CLIP	22100165
MIRT448042	hsa-miR-146b-5p	PAR-CLIP	22100165
MIRT448041	hsa-miR-7153-5p	PAR-CLIP	22100165
MIRT448040	hsa-miR-6878-5p	PAR-CLIP	22100165
MIRT448039	hsa-miR-3175	PAR-CLIP	22100165
MIRT448038	hsa-miR-1343-5p	PAR-CLIP	22100165
MIRT448037	hsa-miR-939-5p	PAR-CLIP	22100165
MIRT448035	hsa-miR-6825-5p	PAR-CLIP	22100165
MIRT448036	hsa-miR-3150a-3p	PAR-CLIP	22100165
MIRT448034	hsa-miR-6763-5p	PAR-CLIP	22100165
MIRT1341890	hsa-miR-103a	CLIP-seq
MIRT1341891	hsa-miR-107	CLIP-seq
MIRT1341892	hsa-miR-1243	CLIP-seq
MIRT1341893	hsa-miR-1252	CLIP-seq
MIRT1341894	hsa-miR-1289	CLIP-seq
MIRT1341895	hsa-miR-1976	CLIP-seq
MIRT1341896	hsa-miR-23a	CLIP-seq
MIRT1341897	hsa-miR-23b	CLIP-seq
MIRT1341898	hsa-miR-23c	CLIP-seq
MIRT1341899	hsa-miR-3125	CLIP-seq
MIRT1341900	hsa-miR-3135	CLIP-seq
MIRT1341901	hsa-miR-3198	CLIP-seq
MIRT1341902	hsa-miR-34b	CLIP-seq
MIRT1341903	hsa-miR-3622a-3p	CLIP-seq
MIRT1341904	hsa-miR-3622b-3p	CLIP-seq
MIRT1341905	hsa-miR-3654	CLIP-seq
MIRT1341906	hsa-miR-3660	CLIP-seq
MIRT1341907	hsa-miR-371-5p	CLIP-seq
MIRT1341908	hsa-miR-3907	CLIP-seq
MIRT1341909	hsa-miR-3916	CLIP-seq
MIRT1341910	hsa-miR-3974	CLIP-seq
MIRT1341911	hsa-miR-4279	CLIP-seq
MIRT1341912	hsa-miR-4294	CLIP-seq
MIRT1341913	hsa-miR-4309	CLIP-seq
MIRT1341914	hsa-miR-4427	CLIP-seq
MIRT1341915	hsa-miR-4438	CLIP-seq
MIRT1341916	hsa-miR-4496	CLIP-seq
MIRT1341917	hsa-miR-4514	CLIP-seq
MIRT1341918	hsa-miR-4526	CLIP-seq
MIRT1341919	hsa-miR-4533	CLIP-seq
MIRT1341920	hsa-miR-4680-3p	CLIP-seq
MIRT1341921	hsa-miR-4681	CLIP-seq
MIRT1341922	hsa-miR-4687-3p	CLIP-seq
MIRT1341923	hsa-miR-4692	CLIP-seq
MIRT1341924	hsa-miR-4704-3p	CLIP-seq
MIRT1341925	hsa-miR-4704-5p	CLIP-seq
MIRT1341926	hsa-miR-4728-3p	CLIP-seq
MIRT1341927	hsa-miR-4742-5p	CLIP-seq
MIRT1341928	hsa-miR-485-3p	CLIP-seq
MIRT1341929	hsa-miR-5095	CLIP-seq
MIRT1341930	hsa-miR-558	CLIP-seq
MIRT1341931	hsa-miR-877	CLIP-seq
MIRT1341932	hsa-miR-940	CLIP-seq
MIRT2101203	hsa-miR-204	CLIP-seq
MIRT2101204	hsa-miR-211	CLIP-seq
MIRT2101205	hsa-miR-3121-5p	CLIP-seq
MIRT2101206	hsa-miR-331-3p	CLIP-seq
MIRT1341902	hsa-miR-34b	CLIP-seq
MIRT1341903	hsa-miR-3622a-3p	CLIP-seq
MIRT1341904	hsa-miR-3622b-3p	CLIP-seq
MIRT2101207	hsa-miR-4281	CLIP-seq
MIRT1341915	hsa-miR-4438	CLIP-seq
MIRT2101208	hsa-miR-4658	CLIP-seq
MIRT1341924	hsa-miR-4704-3p	CLIP-seq
MIRT1341927	hsa-miR-4742-5p	CLIP-seq
MIRT2101209	hsa-miR-4758-5p	CLIP-seq
MIRT2101210	hsa-miR-4765	CLIP-seq
MIRT1341929	hsa-miR-5095	CLIP-seq
MIRT1341930	hsa-miR-558	CLIP-seq
MIRT2325579	hsa-miR-3064-5p	CLIP-seq
MIRT2325580	hsa-miR-3126-5p	CLIP-seq
MIRT2325581	hsa-miR-3136-3p	CLIP-seq
MIRT2325582	hsa-miR-328	CLIP-seq
MIRT2325583	hsa-miR-3613-3p	CLIP-seq
MIRT2325584	hsa-miR-3615	CLIP-seq
MIRT2325585	hsa-miR-3620	CLIP-seq
MIRT2325586	hsa-miR-3919	CLIP-seq
MIRT2325587	hsa-miR-3925-5p	CLIP-seq
MIRT2325588	hsa-miR-3942-3p	CLIP-seq
MIRT1341915	hsa-miR-4438	CLIP-seq
MIRT2325589	hsa-miR-4463	CLIP-seq
MIRT2325590	hsa-miR-4732-3p	CLIP-seq
MIRT2325591	hsa-miR-4756-3p	CLIP-seq
MIRT2325592	hsa-miR-589	CLIP-seq
MIRT2325593	hsa-miR-892b	CLIP-seq
MIRT2394293	hsa-miR-3664-3p	CLIP-seq
MIRT2433053	hsa-miR-128	CLIP-seq
MIRT2433054	hsa-miR-144	CLIP-seq
MIRT2433055	hsa-miR-27a	CLIP-seq
MIRT2433056	hsa-miR-27b	CLIP-seq
MIRT2433057	hsa-miR-3122	CLIP-seq
MIRT2433058	hsa-miR-3140-3p	CLIP-seq
MIRT2433059	hsa-miR-3153	CLIP-seq
MIRT2433060	hsa-miR-330-3p	CLIP-seq
MIRT2433061	hsa-miR-3913-5p	CLIP-seq
MIRT2433062	hsa-miR-4272	CLIP-seq
MIRT2433063	hsa-miR-4464	CLIP-seq
MIRT2433064	hsa-miR-4502	CLIP-seq
MIRT2433065	hsa-miR-4661-3p	CLIP-seq
MIRT2433066	hsa-miR-4668-5p	CLIP-seq
MIRT2433067	hsa-miR-4748	CLIP-seq
MIRT2433068	hsa-miR-4803	CLIP-seq
MIRT2433069	hsa-miR-5096	CLIP-seq
MIRT2433070	hsa-miR-510	CLIP-seq
MIRT2433071	hsa-miR-512-5p	CLIP-seq
MIRT2433072	hsa-miR-513a-5p	CLIP-seq
MIRT2433073	hsa-miR-539	CLIP-seq
MIRT2433074	hsa-miR-651	CLIP-seq
MIRT2433075	hsa-miR-759	CLIP-seq
MIRT2433076	hsa-miR-935	CLIP-seq
MIRT2440199	hsa-miR-1183	CLIP-seq
MIRT2440200	hsa-miR-1236	CLIP-seq
MIRT2440201	hsa-miR-1238	CLIP-seq
MIRT2440202	hsa-miR-127-5p	CLIP-seq
MIRT2440203	hsa-miR-1280	CLIP-seq
MIRT2440204	hsa-miR-1285	CLIP-seq
MIRT2440205	hsa-miR-192	CLIP-seq
MIRT2440206	hsa-miR-193a-5p	CLIP-seq
MIRT2440207	hsa-miR-2115	CLIP-seq
MIRT2440208	hsa-miR-215	CLIP-seq
MIRT1341896	hsa-miR-23a	CLIP-seq
MIRT1341897	hsa-miR-23b	CLIP-seq
MIRT1341898	hsa-miR-23c	CLIP-seq
MIRT2325579	hsa-miR-3064-5p	CLIP-seq
MIRT2440209	hsa-miR-3115	CLIP-seq
MIRT2440210	hsa-miR-3120-3p	CLIP-seq
MIRT2433057	hsa-miR-3122	CLIP-seq
MIRT2433059	hsa-miR-3153	CLIP-seq
MIRT2440211	hsa-miR-3187-5p	CLIP-seq
MIRT2440212	hsa-miR-320a	CLIP-seq
MIRT2440213	hsa-miR-320b	CLIP-seq
MIRT2440214	hsa-miR-320c	CLIP-seq
MIRT2440215	hsa-miR-320d	CLIP-seq
MIRT2440216	hsa-miR-335	CLIP-seq
MIRT2440217	hsa-miR-34c-3p	CLIP-seq
MIRT1341903	hsa-miR-3622a-3p	CLIP-seq
MIRT1341904	hsa-miR-3622b-3p	CLIP-seq
MIRT2440218	hsa-miR-3670	CLIP-seq
MIRT2440219	hsa-miR-3672	CLIP-seq
MIRT2440220	hsa-miR-3685	CLIP-seq
MIRT2440221	hsa-miR-378g	CLIP-seq
MIRT2433061	hsa-miR-3913-5p	CLIP-seq
MIRT2440222	hsa-miR-3977	CLIP-seq
MIRT2440223	hsa-miR-409-3p	CLIP-seq
MIRT2440224	hsa-miR-4251	CLIP-seq
MIRT2440225	hsa-miR-4314	CLIP-seq
MIRT2440226	hsa-miR-4324	CLIP-seq
MIRT2440227	hsa-miR-4325	CLIP-seq
MIRT2440228	hsa-miR-4329	CLIP-seq
MIRT2440229	hsa-miR-4424	CLIP-seq
MIRT2440230	hsa-miR-4429	CLIP-seq
MIRT2325589	hsa-miR-4463	CLIP-seq
MIRT2433063	hsa-miR-4464	CLIP-seq
MIRT2440231	hsa-miR-4486	CLIP-seq
MIRT2433064	hsa-miR-4502	CLIP-seq
MIRT2440232	hsa-miR-4521	CLIP-seq
MIRT2440233	hsa-miR-4536	CLIP-seq
MIRT2433066	hsa-miR-4668-5p	CLIP-seq
MIRT2440234	hsa-miR-4691-5p	CLIP-seq
MIRT2440235	hsa-miR-4693-5p	CLIP-seq
MIRT2433067	hsa-miR-4748	CLIP-seq
MIRT2440236	hsa-miR-4762-3p	CLIP-seq
MIRT2440237	hsa-miR-4778-5p	CLIP-seq
MIRT2440238	hsa-miR-4793-3p	CLIP-seq
MIRT2433070	hsa-miR-510	CLIP-seq
MIRT2433071	hsa-miR-512-5p	CLIP-seq
MIRT2440239	hsa-miR-516a-3p	CLIP-seq
MIRT2433073	hsa-miR-539	CLIP-seq
MIRT2440240	hsa-miR-548aa	CLIP-seq
MIRT2440241	hsa-miR-549	CLIP-seq
MIRT2440242	hsa-miR-580	CLIP-seq
MIRT2440243	hsa-miR-606	CLIP-seq
MIRT2440244	hsa-miR-612	CLIP-seq
MIRT2440245	hsa-miR-630	CLIP-seq
MIRT2440246	hsa-miR-642b	CLIP-seq
MIRT2433075	hsa-miR-759	CLIP-seq
MIRT2325593	hsa-miR-892b	CLIP-seq
MIRT2433076	hsa-miR-935	CLIP-seq
MIRT2459203	hsa-miR-2276	CLIP-seq
MIRT2459204	hsa-miR-4696	CLIP-seq
MIRT2621219	hsa-miR-105	CLIP-seq
MIRT2621220	hsa-miR-10a	CLIP-seq
MIRT2621221	hsa-miR-10b	CLIP-seq
MIRT2440199	hsa-miR-1183	CLIP-seq
MIRT2440200	hsa-miR-1236	CLIP-seq
MIRT2440201	hsa-miR-1238	CLIP-seq
MIRT2440204	hsa-miR-1285	CLIP-seq
MIRT2621222	hsa-miR-1343	CLIP-seq
MIRT2621223	hsa-miR-142-5p	CLIP-seq
MIRT2621224	hsa-miR-1538	CLIP-seq
MIRT2621225	hsa-miR-1913	CLIP-seq
MIRT2440205	hsa-miR-192	CLIP-seq
MIRT2440206	hsa-miR-193a-5p	CLIP-seq
MIRT2621226	hsa-miR-2110	CLIP-seq
MIRT2440208	hsa-miR-215	CLIP-seq
MIRT1341896	hsa-miR-23a	CLIP-seq
MIRT1341897	hsa-miR-23b	CLIP-seq
MIRT1341898	hsa-miR-23c	CLIP-seq
MIRT2440209	hsa-miR-3115	CLIP-seq
MIRT2621227	hsa-miR-3117-5p	CLIP-seq
MIRT2440210	hsa-miR-3120-3p	CLIP-seq
MIRT2433057	hsa-miR-3122	CLIP-seq
MIRT2621228	hsa-miR-3129-3p	CLIP-seq
MIRT2433059	hsa-miR-3153	CLIP-seq
MIRT2440211	hsa-miR-3187-5p	CLIP-seq
MIRT2621229	hsa-miR-3199	CLIP-seq
MIRT2440212	hsa-miR-320a	CLIP-seq
MIRT2440213	hsa-miR-320b	CLIP-seq
MIRT2440214	hsa-miR-320c	CLIP-seq
MIRT2440215	hsa-miR-320d	CLIP-seq
MIRT2621230	hsa-miR-324-3p	CLIP-seq
MIRT2440217	hsa-miR-34c-3p	CLIP-seq
MIRT1341903	hsa-miR-3622a-3p	CLIP-seq
MIRT1341904	hsa-miR-3622b-3p	CLIP-seq
MIRT2440218	hsa-miR-3670	CLIP-seq
MIRT2621231	hsa-miR-3714	CLIP-seq
MIRT2440221	hsa-miR-378g	CLIP-seq
MIRT2621232	hsa-miR-383	CLIP-seq
MIRT2433061	hsa-miR-3913-5p	CLIP-seq
MIRT2621233	hsa-miR-3914	CLIP-seq
MIRT2621234	hsa-miR-3920	CLIP-seq
MIRT2621235	hsa-miR-3921	CLIP-seq
MIRT2621236	hsa-miR-3941	CLIP-seq
MIRT2440223	hsa-miR-409-3p	CLIP-seq
MIRT2621237	hsa-miR-425	CLIP-seq
MIRT2440224	hsa-miR-4251	CLIP-seq
MIRT2621238	hsa-miR-4269	CLIP-seq
MIRT2621239	hsa-miR-431	CLIP-seq
MIRT2440225	hsa-miR-4314	CLIP-seq
MIRT2440227	hsa-miR-4325	CLIP-seq
MIRT2440228	hsa-miR-4329	CLIP-seq
MIRT2440230	hsa-miR-4429	CLIP-seq
MIRT2621240	hsa-miR-4437	CLIP-seq
MIRT1341915	hsa-miR-4438	CLIP-seq
MIRT2621241	hsa-miR-4450	CLIP-seq
MIRT2621242	hsa-miR-4452	CLIP-seq
MIRT2433063	hsa-miR-4464	CLIP-seq
MIRT2440231	hsa-miR-4486	CLIP-seq
MIRT2433064	hsa-miR-4502	CLIP-seq
MIRT2440232	hsa-miR-4521	CLIP-seq
MIRT2621243	hsa-miR-4522	CLIP-seq
MIRT2440233	hsa-miR-4536	CLIP-seq
MIRT2621244	hsa-miR-4633-3p	CLIP-seq
MIRT2621245	hsa-miR-4643	CLIP-seq
MIRT2621246	hsa-miR-4653-5p	CLIP-seq
MIRT2621247	hsa-miR-466	CLIP-seq
MIRT2433066	hsa-miR-4668-5p	CLIP-seq
MIRT2621248	hsa-miR-4672	CLIP-seq
MIRT2440234	hsa-miR-4691-5p	CLIP-seq
MIRT2440235	hsa-miR-4693-5p	CLIP-seq
MIRT2621249	hsa-miR-4714-5p	CLIP-seq
MIRT2621250	hsa-miR-4745-3p	CLIP-seq
MIRT2433067	hsa-miR-4748	CLIP-seq
MIRT2621251	hsa-miR-4749-3p	CLIP-seq
MIRT2621252	hsa-miR-4761-5p	CLIP-seq
MIRT2440237	hsa-miR-4778-5p	CLIP-seq
MIRT2621253	hsa-miR-4789-3p	CLIP-seq
MIRT2440238	hsa-miR-4793-3p	CLIP-seq
MIRT2433070	hsa-miR-510	CLIP-seq
MIRT2433071	hsa-miR-512-5p	CLIP-seq
MIRT2433073	hsa-miR-539	CLIP-seq
MIRT2621254	hsa-miR-548a-5p	CLIP-seq
MIRT2440240	hsa-miR-548aa	CLIP-seq
MIRT2621255	hsa-miR-548ab	CLIP-seq
MIRT2621256	hsa-miR-548ak	CLIP-seq
MIRT2621257	hsa-miR-548an	CLIP-seq
MIRT2621258	hsa-miR-548b-5p	CLIP-seq
MIRT2621259	hsa-miR-548c-5p	CLIP-seq
MIRT2621260	hsa-miR-548d-5p	CLIP-seq
MIRT2621261	hsa-miR-548h	CLIP-seq
MIRT2621262	hsa-miR-548i	CLIP-seq
MIRT2621263	hsa-miR-548j	CLIP-seq
MIRT2621264	hsa-miR-548k	CLIP-seq
MIRT2621265	hsa-miR-548l	CLIP-seq
MIRT2621266	hsa-miR-548w	CLIP-seq
MIRT2621267	hsa-miR-548y	CLIP-seq
MIRT2621268	hsa-miR-559	CLIP-seq
MIRT2621269	hsa-miR-595	CLIP-seq
MIRT2440243	hsa-miR-606	CLIP-seq
MIRT2440244	hsa-miR-612	CLIP-seq
MIRT2621270	hsa-miR-627	CLIP-seq
MIRT2440245	hsa-miR-630	CLIP-seq
MIRT2621271	hsa-miR-635	CLIP-seq
MIRT2440246	hsa-miR-642b	CLIP-seq
MIRT2433075	hsa-miR-759	CLIP-seq
MIRT2621272	hsa-miR-924	CLIP-seq
MIRT2433076	hsa-miR-935	CLIP-seq
MIRT1341932	hsa-miR-940	CLIP-seq
MIRT2621219	hsa-miR-105	CLIP-seq
MIRT2440199	hsa-miR-1183	CLIP-seq
MIRT2440200	hsa-miR-1236	CLIP-seq
MIRT2440201	hsa-miR-1238	CLIP-seq
MIRT2440202	hsa-miR-127-5p	CLIP-seq
MIRT2440204	hsa-miR-1285	CLIP-seq
MIRT2690553	hsa-miR-1303	CLIP-seq
MIRT2621222	hsa-miR-1343	CLIP-seq
MIRT2621223	hsa-miR-142-5p	CLIP-seq
MIRT2621225	hsa-miR-1913	CLIP-seq
MIRT2440205	hsa-miR-192	CLIP-seq
MIRT2440206	hsa-miR-193a-5p	CLIP-seq
MIRT2621226	hsa-miR-2110	CLIP-seq
MIRT2440207	hsa-miR-2115	CLIP-seq
MIRT2440208	hsa-miR-215	CLIP-seq
MIRT1341896	hsa-miR-23a	CLIP-seq
MIRT1341897	hsa-miR-23b	CLIP-seq
MIRT1341898	hsa-miR-23c	CLIP-seq
MIRT2440209	hsa-miR-3115	CLIP-seq
MIRT2621227	hsa-miR-3117-5p	CLIP-seq
MIRT2440210	hsa-miR-3120-3p	CLIP-seq
MIRT2433057	hsa-miR-3122	CLIP-seq
MIRT2621228	hsa-miR-3129-3p	CLIP-seq
MIRT2433059	hsa-miR-3153	CLIP-seq
MIRT2440211	hsa-miR-3187-5p	CLIP-seq
MIRT2621229	hsa-miR-3199	CLIP-seq
MIRT2440212	hsa-miR-320a	CLIP-seq
MIRT2440213	hsa-miR-320b	CLIP-seq
MIRT2440214	hsa-miR-320c	CLIP-seq
MIRT2440215	hsa-miR-320d	CLIP-seq
MIRT2621230	hsa-miR-324-3p	CLIP-seq
MIRT2440217	hsa-miR-34c-3p	CLIP-seq
MIRT1341903	hsa-miR-3622a-3p	CLIP-seq
MIRT1341904	hsa-miR-3622b-3p	CLIP-seq
MIRT2440218	hsa-miR-3670	CLIP-seq
MIRT2440220	hsa-miR-3685	CLIP-seq
MIRT2621231	hsa-miR-3714	CLIP-seq
MIRT2440221	hsa-miR-378g	CLIP-seq
MIRT2621232	hsa-miR-383	CLIP-seq
MIRT2433061	hsa-miR-3913-5p	CLIP-seq
MIRT2621233	hsa-miR-3914	CLIP-seq
MIRT2621235	hsa-miR-3921	CLIP-seq
MIRT2621236	hsa-miR-3941	CLIP-seq
MIRT2440222	hsa-miR-3977	CLIP-seq
MIRT2440223	hsa-miR-409-3p	CLIP-seq
MIRT2621237	hsa-miR-425	CLIP-seq
MIRT2440224	hsa-miR-4251	CLIP-seq
MIRT2621238	hsa-miR-4269	CLIP-seq
MIRT2621239	hsa-miR-431	CLIP-seq
MIRT2440225	hsa-miR-4314	CLIP-seq
MIRT2440226	hsa-miR-4324	CLIP-seq
MIRT2440227	hsa-miR-4325	CLIP-seq
MIRT2440228	hsa-miR-4329	CLIP-seq
MIRT2440230	hsa-miR-4429	CLIP-seq
MIRT2621240	hsa-miR-4437	CLIP-seq
MIRT1341915	hsa-miR-4438	CLIP-seq
MIRT2621241	hsa-miR-4450	CLIP-seq
MIRT2433063	hsa-miR-4464	CLIP-seq
MIRT2440231	hsa-miR-4486	CLIP-seq
MIRT2433064	hsa-miR-4502	CLIP-seq
MIRT2440232	hsa-miR-4521	CLIP-seq
MIRT2621243	hsa-miR-4522	CLIP-seq
MIRT2440233	hsa-miR-4536	CLIP-seq
MIRT2621244	hsa-miR-4633-3p	CLIP-seq
MIRT2621245	hsa-miR-4643	CLIP-seq
MIRT2621246	hsa-miR-4653-5p	CLIP-seq
MIRT2621247	hsa-miR-466	CLIP-seq
MIRT2433066	hsa-miR-4668-5p	CLIP-seq
MIRT2621248	hsa-miR-4672	CLIP-seq
MIRT2440234	hsa-miR-4691-5p	CLIP-seq
MIRT2440235	hsa-miR-4693-5p	CLIP-seq
MIRT2621249	hsa-miR-4714-5p	CLIP-seq
MIRT2433067	hsa-miR-4748	CLIP-seq
MIRT2621251	hsa-miR-4749-3p	CLIP-seq
MIRT2621252	hsa-miR-4761-5p	CLIP-seq
MIRT2440236	hsa-miR-4762-3p	CLIP-seq
MIRT2440237	hsa-miR-4778-5p	CLIP-seq
MIRT2621253	hsa-miR-4789-3p	CLIP-seq
MIRT2440238	hsa-miR-4793-3p	CLIP-seq
MIRT2433070	hsa-miR-510	CLIP-seq
MIRT2433071	hsa-miR-512-5p	CLIP-seq
MIRT2440239	hsa-miR-516a-3p	CLIP-seq
MIRT2433073	hsa-miR-539	CLIP-seq
MIRT2621254	hsa-miR-548a-5p	CLIP-seq
MIRT2440240	hsa-miR-548aa	CLIP-seq
MIRT2621255	hsa-miR-548ab	CLIP-seq
MIRT2621256	hsa-miR-548ak	CLIP-seq
MIRT2621257	hsa-miR-548an	CLIP-seq
MIRT2621258	hsa-miR-548b-5p	CLIP-seq
MIRT2621259	hsa-miR-548c-5p	CLIP-seq
MIRT2621260	hsa-miR-548d-5p	CLIP-seq
MIRT2621261	hsa-miR-548h	CLIP-seq
MIRT2621262	hsa-miR-548i	CLIP-seq
MIRT2621263	hsa-miR-548j	CLIP-seq
MIRT2621264	hsa-miR-548k	CLIP-seq
MIRT2621265	hsa-miR-548l	CLIP-seq
MIRT2621266	hsa-miR-548w	CLIP-seq
MIRT2621267	hsa-miR-548y	CLIP-seq
MIRT2621268	hsa-miR-559	CLIP-seq
MIRT2440242	hsa-miR-580	CLIP-seq
MIRT2440243	hsa-miR-606	CLIP-seq
MIRT2440244	hsa-miR-612	CLIP-seq
MIRT2440245	hsa-miR-630	CLIP-seq
MIRT2621271	hsa-miR-635	CLIP-seq
MIRT2440246	hsa-miR-642b	CLIP-seq
MIRT2433075	hsa-miR-759	CLIP-seq
MIRT2433076	hsa-miR-935	CLIP-seq
MIRT1341932	hsa-miR-940	CLIP-seq

Show/Hide all (6)

Transcription factor	Regulation	Reference
DNMT1	Unknown	23770846;24374650
DNMT3A	Unknown	24374650
EZH2	Unknown	21515604
GLI1	Activation	19930158
HDAC1	Unknown	23770846
MYC	Repression	20697356

131

Show/Hide all (131)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001649	Process	Osteoblast differentiation	IEP	16149051
GO:0001657	Process	Ureteric bud development	IEA
GO:0001756	Process	Somitogenesis	IEA
GO:0001843	Process	Neural tube closure	IEA
GO:0001954	Process	Positive regulation of cell-matrix adhesion	ISS
GO:0002244	Process	Hematopoietic progenitor cell differentiation	IDA	19778523
GO:0003002	Process	Regionalization	IEA
GO:0004197	Function	Cysteine-type endopeptidase activity	IMP	14581477
GO:0005109	Function	Frizzled binding	IPI	1927703, 10347172, 19277043
GO:0005515	Function	Protein binding	IPI	10347172, 32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	HDA	20551380
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	9192640, 10980594, 17500071
GO:0005829	Component	Cytosol	IDA	14581477
GO:0005886	Component	Plasma membrane	ISS
GO:0008201	Function	Heparin binding	IDA	9192640, 10660608, 11741940
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	10980594
GO:0008285	Process	Negative regulation of cell population proliferation	IDA	10347172, 17443492, 19277043, 20208569
GO:0008584	Process	Male gonad development	IEA
GO:0008585	Process	Female gonad development	IEA
GO:0009267	Process	Cellular response to starvation	IEP	9724099, 11932307
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0009950	Process	Dorsal/ventral axis specification	IDA	9192640
GO:0009952	Process	Anterior/posterior pattern specification	IEA
GO:0009986	Component	Cell surface	IDA	9192640
GO:0010564	Process	Regulation of cell cycle process	IMP	9724099
GO:0010629	Process	Negative regulation of gene expression	IDA	10980594
GO:0010629	Process	Negative regulation of gene expression	IEA
GO:0010719	Process	Negative regulation of epithelial to mesenchymal transition	IDA	19095296
GO:0010975	Process	Regulation of neuron projection development	IEA
GO:0014034	Process	Neural crest cell fate commitment	IEA
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0016055	Process	Wnt signaling pathway	ISS
GO:0017147	Function	Wnt-protein binding	IBA
GO:0017147	Function	Wnt-protein binding	IDA	17462603
GO:0017147	Function	Wnt-protein binding	IPI	10347172, 10660608, 17462603, 19072540, 24080158
GO:0017147	Function	Wnt-protein binding	NAS	24431302
GO:0021915	Process	Neural tube development	IEA
GO:0030097	Process	Hemopoiesis	IEA
GO:0030097	Process	Hemopoiesis	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0030177	Process	Positive regulation of Wnt signaling pathway	IDA	10660608
GO:0030178	Process	Negative regulation of Wnt signaling pathway	IDA	10660608, 17500071, 20208569
GO:0030178	Process	Negative regulation of Wnt signaling pathway	IEA
GO:0030178	Process	Negative regulation of Wnt signaling pathway	IGI	9192640
GO:0030178	Process	Negative regulation of Wnt signaling pathway	NAS	24431302
GO:0030279	Process	Negative regulation of ossification	IDA	15677765
GO:0030279	Process	Negative regulation of ossification	IEA
GO:0030279	Process	Negative regulation of ossification	IEA
GO:0030279	Process	Negative regulation of ossification	IMP	19254787
GO:0030307	Process	Positive regulation of cell growth	IDA	10980594
GO:0030308	Process	Negative regulation of cell growth	IDA	19569235, 20208569
GO:0030316	Process	Osteoclast differentiation	IEA
GO:0030336	Process	Negative regulation of cell migration	IDA	10980594
GO:0030509	Process	BMP signaling pathway	IEA
GO:0030514	Process	Negative regulation of BMP signaling pathway	IEA
GO:0031012	Component	Extracellular matrix	HDA	20551380
GO:0031012	Component	Extracellular matrix	HDA	27559042
GO:0031012	Component	Extracellular matrix	IDA	9192640, 10347172
GO:0033689	Process	Negative regulation of osteoblast proliferation	IEA
GO:0033689	Process	Negative regulation of osteoblast proliferation	IEA
GO:0033689	Process	Negative regulation of osteoblast proliferation	IMP	19072540
GO:0035019	Process	Somatic stem cell population maintenance	IEA
GO:0035567	Process	Non-canonical Wnt signaling pathway	IBA
GO:0042802	Function	Identical protein binding	IPI	10347172
GO:0043065	Process	Positive regulation of apoptotic process	IDA	9391078, 15677765
GO:0043065	Process	Positive regulation of apoptotic process	IMP	9724099, 16149051, 19254787
GO:0043066	Process	Negative regulation of apoptotic process	IMP	11932307, 14581477, 16149051, 19723665
GO:0045578	Process	Negative regulation of B cell differentiation	IEA
GO:0045578	Process	Negative regulation of B cell differentiation	IMP	18941195
GO:0045600	Process	Positive regulation of fat cell differentiation	IDA	12055200
GO:0045600	Process	Positive regulation of fat cell differentiation	IDA	15886250
GO:0045668	Process	Negative regulation of osteoblast differentiation	IEA
GO:0045671	Process	Negative regulation of osteoclast differentiation	IEA
GO:0045765	Process	Regulation of angiogenesis	ISS
GO:0045880	Process	Positive regulation of smoothened signaling pathway	IMP	17035233
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	10660608, 19095296, 19277043, 20234818
GO:0045892	Process	Negative regulation of DNA-templated transcription	IMP	16532032
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	10660608, 15886250, 19569235
GO:0045893	Process	Positive regulation of DNA-templated transcription	IMP	19723665
GO:0046546	Process	Development of primary male sexual characteristics	IEA
GO:0046851	Process	Negative regulation of bone remodeling	IMP	19072540
GO:0048147	Process	Negative regulation of fibroblast proliferation	IDA	19734317
GO:0048546	Process	Digestive tract morphogenesis	IEA
GO:0048863	Process	Stem cell differentiation	IEA
GO:0050680	Process	Negative regulation of epithelial cell proliferation	IDA	19095296
GO:0050732	Process	Negative regulation of peptidyl-tyrosine phosphorylation	IDA	10980594
GO:0051496	Process	Positive regulation of stress fiber assembly	ISS
GO:0051894	Process	Positive regulation of focal adhesion assembly	ISS
GO:0060070	Process	Canonical Wnt signaling pathway	IBA
GO:0060070	Process	Canonical Wnt signaling pathway	IDA	18787224
GO:0060070	Process	Canonical Wnt signaling pathway	IEA
GO:0060070	Process	Canonical Wnt signaling pathway	IEA
GO:0060071	Process	Wnt signaling pathway, planar cell polarity pathway	IEA
GO:0060218	Process	Hematopoietic stem cell differentiation	IDA	19778523
GO:0060346	Process	Bone trabecula formation	IEA
GO:0060527	Process	Prostate epithelial cord arborization involved in prostate glandular acinus morphogenesis	IEA
GO:0060687	Process	Regulation of branching involved in prostate gland morphogenesis	IEA
GO:0060766	Process	Negative regulation of androgen receptor signaling pathway	IDA	19277043
GO:0070062	Component	Extracellular exosome	HDA	19199708
GO:0071305	Process	Cellular response to vitamin D	IEP	16149051
GO:0071347	Process	Cellular response to interleukin-1	IEP	16149051
GO:0071356	Process	Cellular response to tumor necrosis factor	IDA	9391078
GO:0071380	Process	Cellular response to prostaglandin E stimulus	IEP	16149051
GO:0071391	Process	Cellular response to estrogen stimulus	IDA	18941195
GO:0071391	Process	Cellular response to estrogen stimulus	IEA
GO:0071392	Process	Cellular response to estradiol stimulus	IEP	11932307
GO:0071456	Process	Cellular response to hypoxia	IEP	11932307
GO:0071481	Process	Cellular response to X-ray	IEA
GO:0071542	Process	Dopaminergic neuron differentiation	IEA
GO:0071560	Process	Cellular response to transforming growth factor beta stimulus	IEP	16149051
GO:0071773	Process	Cellular response to BMP stimulus	IEP	16149051
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IDA	9391078, 10347172, 16149051, 17443492, 17471511, 17994217, 19095296, 19277043, 19569235
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IEA
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IGI	17462603, 24080158
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IMP	9724099, 16532032, 17035233, 19072540, 19254787
GO:0090175	Process	Regulation of establishment of planar polarity	IEA
GO:0090244	Process	Wnt signaling pathway involved in somitogenesis	IEA
GO:0090246	Process	Convergent extension involved in somitogenesis	IEA
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	IDA	18941195
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	IGI	24080158
GO:0097191	Process	Extrinsic apoptotic signaling pathway	IEA
GO:1902043	Process	Positive regulation of extrinsic apoptotic signaling pathway via death domain receptors	IDA	9391078
GO:1904956	Process	Regulation of midbrain dopaminergic neuron differentiation	IEA
GO:2000052	Process	Positive regulation of non-canonical Wnt signaling pathway	IDA	19569235
GO:2000270	Process	Negative regulation of fibroblast apoptotic process	IDA	14581477
GO:2000271	Process	Positive regulation of fibroblast apoptotic process	IDA	14581477
GO:2001238	Process	Positive regulation of extrinsic apoptotic signaling pathway	IEA
GO:2001238	Process	Positive regulation of extrinsic apoptotic signaling pathway	IEA

MIM	HGNC	e!Ensembl
604156	10776	ENSG00000104332

Q8N474

Protein name

Secreted frizzled-related protein 1 (FRP-1) (sFRP-1) (Secreted apoptosis-related protein 2) (SARP-2)

Protein function

Soluble frizzled-related proteins (sFRPS) function as modulators of Wnt signaling through direct interaction with Wnts. They have a role in regulating cell growth and differentiation in specific cell types. SFRP1 decreases intracellular beta-cat

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01392	Fz	58 → 165	Fz domain	Domain
PF01759	NTR	200 → 296	UNC-6/NTR/C345C module	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed. Absent from lung, liver and peripheral blood leukocytes. Highest levels in heart and fetal kidney. Also expressed in testis, ovary, fetal brain and lung, leiomyomal cells, myometrial cells and vascular smooth muscle c

Sequence

MGIGRSEGGRRGAALGVLLALGAALLAVGSASEYDYVSFQSDIGPYQSGRFYTKPPQCVD
IPADLRLCHNVGYKKMVLPNLLEHETMAEVKQQASSWVPLLNKNCHAGTQVFLCSLFAPV
CLDRPIYPCRWLCEAVRDSCEPVMQFFGFYWPEMLKCDKFPEGDVCIAMTPPNATEASKP
QGTTVCPPCDNELKSEAIIEHLCASEFALRMKIKEVKKENGDKKIVPKKKKPLKLGPIKK
KDLKKLVLYLKNGADCPCHQLDNLSHHFLIMGRKVKSQYLLTAIHKWDKKNKEFKNFMKK
MKNHECPTFQSVFK

Sequence length

314

Interactions

View interactions

	KEGG
	Wnt signaling pathway

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (14)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BILIARY TRACT DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART DISEASES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE, DIASTOLIC	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IDIOPATHIC PULMONARY FIBROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEIOMYOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (261)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	22031861		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	16407829		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	16991125		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	15825175, 21567192		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	23802127, 24643460		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	16523202, 17131472, 17762966, 25432628, 26482433, 28058013, 30578081		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	26482433		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	20486992, 20628379, 20856206, 28708837		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	20208569, 21107850		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aphasia	Aphasia	Pubtator	27251476	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	12415580		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	12428226, 21515604	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	25147914	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	24305703, 30394013		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	24305703, 30394013	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	15825175, 16407829		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	LHGDN	16407829		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	BEFREE	18942711		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	25719802		★★★★★ ★☆☆☆☆ Found in Text Mining only
Biliary Tract Neoplasms	Biliary tract neoplasms	Pubtator	24594839	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	19204725		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bladder Neoplasm	Bladder Neoplasm	BEFREE	14968126, 16410684, 16609023, 19565266, 24133576, 25732201, 28268231		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	LHGDN	16410684, 16609023		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	32783304	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10086345, 11593386, 15289865, 16410723, 16449975, 17726380, 18283316, 18356147, 18990230, 19569235, 20486992, 20716965, 21868547, 22826467, 22986510 View all (12 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	18283316		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	16410723, 19569235, 28099945, 33550915	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	17897439, 18283316, 18990230, 19110721, 20716965, 22026417, 22037257, 22701537, 22826467, 22986510, 23011155, 25036590, 28984209, 30651373, 31638237 View all (5 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinogenesis	Carcinogenesis	Pubtator	21709441, 24949429, 27739564, 31128064, 32236623, 36368958	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	11593386, 14968126		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	35343265	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal Breast	Ductal carcinoma of breast	Pubtator	35343265	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	21709441, 26397159	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	16795071, 18577996, 20079733, 21046672, 22180715, 22351518, 27545991, 32189106, 32293507, 32311840, 34268946, 38062093	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	17626620	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	16410723	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	32050925	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Lobular	Lobular carcinoma	Pubtator	27078887	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	14968126, 19565266, 24133576, 25732201, 28268231		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	16007200, 23802127, 28260111, 28545308, 28605875, 30158579		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	18820670, 37230892, 37533202	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	20154727, 22419128, 22826467, 23572277, 24454902, 34222474	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	26394929	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	27420949	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Endometrioid	Endometrioid cancer	BEFREE	21709441		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	16449975, 24114859, 30829010, 31770484		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	21120523		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	30377735		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	12413893, 19095296		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	12413893, 19095296		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	20208569, 21107850		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	18773859, 24948044, 28230864, 30235453		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	22983262, 24948044, 36368958	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	16423993, 18765431, 19347729		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	CTD_human_DG	30377735		★★★★★ ★☆☆☆☆ Found in Text Mining only
Clear cell adenocarcinoma of ovary	Ovarian adenocarcinoma	BEFREE	20486992		★★★★★ ★☆☆☆☆ Found in Text Mining only
Clear-cell metastatic renal cell carcinoma	Renal Carcinoma	BEFREE	17699851		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cockayne Syndrome, Type I	Cockayne Syndrome	BEFREE	29738529		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	31308530		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	18716850		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	18716850	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	18212756		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	11992124, 14871816, 16523202, 17762966, 19067193, 19730886, 20131317, 21304055, 24929326, 24948044, 24949429, 25405986, 26482433, 27943272, 28058013 View all (5 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	CTD_human_DG	17923031, 18716850		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	15471560, 15526363, 17131472, 18212756, 19404924, 21304055, 22703586, 23975090, 24948044, 25405986, 25991403, 26291085, 26482433, 27245242, 28058013 View all (9 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	16523202, 18795670		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	16523202, 24949429	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	17131472		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	CTD_human_DG	17923031, 18716850		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	28230864		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	17145819, 17353908, 17699851, 18639284, 18949430, 20154727, 22826467		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	12415580, 15818669, 16572458, 16735027, 17237116, 18819822, 23261541, 24096177, 30947534, 9786430		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	PSYGENET_DG	19204725		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Developmental Disabilities	Developmental disability	Pubtator	27251476	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	BEFREE	11593386		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	17889861		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilic Esophagitis	Eosinophilia	Pubtator	37652141	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	24114859, 31770484		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	22171134	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	8639804		★★★★★ ★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP A (disorder)	Anemia	BEFREE	8639804		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	15972578		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	CTD_human_DG	15972578		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	18274669, 31382918		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	LHGDN	18274669		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	Pubtator	23258147	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	31382918		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	24948145		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	30394013	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	24948145		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	24305703, 26337424, 28398872		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	24305703, 26337424, 26712519	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glucocorticoid Receptor Deficiency	Glucocorticoid receptor deficiency/resistance	Pubtator	20555348	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	15886250	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	CTD_human_DG	30377735		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure, Diastolic	Heart Failure	CTD_human_DG	29556499		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatitis C	Hepatitis c	Pubtator	24386373	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	36003399	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	24127655		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	Pubtator	29507645	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	Pubtator	32189106	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary pyropoikilocytosis	Hereditary pyropoikilocytosis	BEFREE	21154739		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperostosis Diffuse Idiopathic Skeletal	Diffuse idiopathic skeletal hyperostosis	Pubtator	28153008	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypophosphatemic Rickets, X-Linked Dominant	Hypophosphatemic Rickets	BEFREE	12791601		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	30065361	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	31308530		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	18716850		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	CTD_human_DG	18716850		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	18716850	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intestinal Cancer	Intestinal Cancer	BEFREE	30255827		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	28062160		★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratoconjunctivitis Sicca	Keratoconjunctivitis Sicca	BEFREE	20447100		★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	BEFREE	20447100, 29381095		★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	Pubtator	23825088, 29860458	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	25253698		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	22419128, 23591200	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	18537968		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	19543515, 20795789, 22031861, 24164743	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	22031861	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	18537968, 22031861, 25347432, 28790854		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukocyte adhesion deficiency type 1	Leukocyte adhesion deficiency	BEFREE	24643460		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	16795071, 17626620, 18592156, 20033841, 21046672, 21884695, 22296502, 22351518, 23770846, 26034368, 26851021		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	28284560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	18592156		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	LHGDN	17443492, 18592156		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Neoplasms	Liver neoplasm	Pubtator	32189106	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	16007200, 16991125		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	16007200		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	29270240	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	24594839, 31128064	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10086345, 11593386, 15289865, 16410723, 16449975, 17726380, 18283316, 18356147, 18990230, 19569235, 20486992, 20716965, 21868547, 22826467, 22986510 View all (14 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	18283316		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	17353908, 22419128		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	16007200, 23802127, 28260111, 28545308, 28605875, 30158579		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	15471560, 16449975, 29146058, 30829010, 31770484		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	18528941		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	16288033, 19277043, 22915211, 24504368, 25719802, 27570179, 29358129		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	11798016, 17297461, 17465504, 17848950, 21567192, 22246241, 23049225, 23927957, 27739564, 28169332, 28401000, 28643146, 29886152		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	14968126, 19565266, 24133576, 25732201, 28268231		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11798016, 16007200, 17353908, 17762966, 18528941, 18639284, 19095296, 19995452, 20033841, 20353273, 20811686, 20848536, 22351518, 22419128, 24305703 View all (17 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	12413893, 19095296		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	15471560, 18212756, 24876104		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	18283316		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	15289865, 16410723, 16449975, 18283316, 19569235, 22701537		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	16410723, 16449975, 17485441, 18035687		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	18283316		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	18283316		★★★★★ ★☆☆☆☆ Found in Text Mining only
Marinesco-Sjogren syndrome	Marinesco-Sjogren Syndrome	BEFREE	15958545		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	16311119, 20208569, 20823417, 21107850		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	20823417	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	21410771		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	21606880	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	20685720, 22964784, 24096618		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	20685720	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	PSYGENET_DG	19204725		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mesothelioma	Mesothelioma	BEFREE	15221014, 20596629		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	31366177	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	20514047		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	BEFREE	30065628		★★★★★ ★☆☆☆☆ Found in Text Mining only
Milroy Disease	Milroy Disease	BEFREE	19299079		★★★★★ ★☆☆☆☆ Found in Text Mining only
Monoclonal Gammopathy of Undetermined Significance	Monoclonal Gammapathies	BEFREE	19299079		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	19299079		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	32046444	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Duchenne	Duchenne muscular dystrophy	Pubtator	18021006	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	23093371		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	19118898, 28468589		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	27391264, 37203392	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	31504423	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	Pubtator	23468642	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Narcolepsy	Narcolepsy	GWASDB_DG	19629137		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	26276746		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Neoplasms	Nasopharyngeal Neoplasms	BEFREE	28812223		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11593386, 11798016, 11992124, 12413893, 14871816, 14968126, 15289865, 15471560, 15825175, 16007200, 16288033, 16410723, 16449975, 16523202, 17353908 View all (42 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	21472018		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	19815336, 20830616, 27434867		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	20830616	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroectodermal Tumor, Primitive	Neuroectodermal Tumors	BEFREE	16311119		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	23354304		★★★★★ ★☆☆☆☆ Found in Text Mining only
Niemann-Pick Disease, Type C	Niemann-Pick Disease	BEFREE	26276746		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	16007200, 20353273, 23802127, 27534621, 28422739		★★★★★ ★☆☆☆☆ Found in Text Mining only
NONAKA MYOPATHY	Inclusion body myopathy	BEFREE	15886250		★★★★★ ★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	16410723		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	20514047, 24885183		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	32749195	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity, Morbid	Obesity	BEFREE	20514047		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	30417652		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis of hip	Osteoarthritis Of Hip	BEFREE	16572458		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	23261541		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteolysis	Osteolysis	Pubtator	25399506	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	19702942, 29319176, 30055306, 31799642		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis, Postmenopausal	Osteoporosis	BEFREE	29319176		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	28260111, 31072914		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	31072914	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	34305100	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	16449975, 30829010, 31770484		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	19095296		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	15471560, 36259450, 37417299	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	16670620, 18528941, 27459115		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Diseases	Pancreatic Diseases	BEFREE	16670620		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	16670620		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	18528941, 18706212		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	16670620, 27891190, 37547756	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	16670620		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	31360191		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parathyroid Adenoma	Parathyroid Adenoma	BEFREE	27071708		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parathyroid Gland Adenocarcinoma	Parathyroid Gland Adenocarcinoma	BEFREE	27071708		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parathyroid Neoplasms	Parathyroid neoplasm	Pubtator	21638518	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peritoneal Neoplasms	Peritoneal neoplasm	Pubtator	32764696	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	33228780	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Premature aging syndrome	Premature aging	BEFREE	23261541		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	16288033, 19277043, 22915211, 24504368, 25719802, 27570179, 29358129		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	15899813, 19277043, 24504368, 25719802, 30177832	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	16847812		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	20595636		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	30586565		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	17353908		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	17145819, 17353908, 17699851, 18639284, 18949430, 20154727, 22419128		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	LHGDN	17353908, 17699851, 18639284, 18949430		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	25253698		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	15235574		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Dystrophies	Retinal Dystrophy	BEFREE	15235574		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	12415580, 16735027, 21515604, 9786430		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	24517116		★★★★★ ★☆☆☆☆ Found in Text Mining only
Seizures	Seizures	Pubtator	40591616	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Senile Plaques	Senile Plaques	BEFREE	31308530		★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	18174455		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sick Sinus Syndrome	Sick sinus syndrome	Pubtator	22986510	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Central	Sleep Apnea	BEFREE	29738529		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	20486992		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	16007200		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spherocytosis Type 1	Spherocytosis	Pubtator	37922232	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	18497987		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	19038436, 30065361, 31734541		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	21567192, 22171134		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	24359512, 29790687, 29900911, 35892344, 39300373	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	27420949		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	28812223		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	31734541		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	11798016, 17297461, 17465504, 17848950, 21567192, 22246241, 23049225, 23927957, 27739564, 28169332, 28401000, 29886152		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	17465504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	17465504, 23049225, 23943784, 27739564, 30902884	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	30593147	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	BEFREE	12415580		★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	23698475		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid associated opthalmopathies	Thyroid eye disease	BEFREE	15886250		★★★★★ ★☆☆☆☆ Found in Text Mining only
Toxic Epidermal Necrolysis	Stevens-Johnson Syndrome	BEFREE	29736687		★★★★★ ★☆☆☆☆ Found in Text Mining only
Transitional Meningioma	Transitional Meningioma	BEFREE	24096618		★★★★★ ★☆☆☆☆ Found in Text Mining only
Trigeminal Neuralgia	Trigeminal neuralgia	Pubtator	38158702	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	22826467, 35507080	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	25033833, 31140870		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	25033833	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Turcot syndrome	Turcot syndrome	Pubtator	30578081	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	20848536, 23546389		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	14968126, 28268231	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	19565266, 21599969, 24133576, 25732201	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	19513747	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	11932307, 15972578		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	CTD_human_DG	15972578		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitamin D-Resistant Rickets, X-Linked	Vitamin D-Dependent Rickets	BEFREE	12791601		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	Pubtator	27193292	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Von Hippel-Lindau Syndrome	Von Hippel-Lindau Syndrome	BEFREE	15526363		★★★★★ ★☆☆☆☆ Found in Text Mining only

SFRP1 (secreted frizzled related protein 1)