Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	64151
Gene name	Non-SMC condensin I complex subunit G
Gene symbol	NCAPG
Synonyms (NCBI Gene)	CAPGCHCGNY-MEL-3YCG1
Chromosome	4
Chromosome location	4p15.31
Summary	This gene encodes a subunit of the condensin complex, which is responsible for the condensation and stabilization of chromosomes during mitosis and meiosis. Phosphorylation of the encoded protein activates the condensin complex. There are pseudogenes for

191

Show/Hide all (191)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000171	hsa-miR-21-5p	Luciferase reporter assayQuantitative proteomic approach	19253296
MIRT016370	hsa-miR-193b-3p	Microarray	20304954
MIRT020693	hsa-miR-155-5p	Proteomics	18668040
MIRT023728	hsa-miR-1-3p	Proteomics	18668040
MIRT025382	hsa-miR-34a-5p	Proteomics	21566225
MIRT031595	hsa-miR-16-5p	Proteomics	18668040
MIRT039450	hsa-miR-421	CLASH	23622248
MIRT054110	hsa-miR-575	Microarray	22995316
MIRT724679	hsa-miR-1250-3p	HITS-CLIP	19536157
MIRT724678	hsa-miR-153-5p	HITS-CLIP	19536157
MIRT724677	hsa-miR-205-5p	HITS-CLIP	19536157
MIRT724676	hsa-miR-4536-5p	HITS-CLIP	19536157
MIRT724675	hsa-miR-5696	HITS-CLIP	19536157
MIRT724674	hsa-miR-579-3p	HITS-CLIP	19536157
MIRT724673	hsa-miR-664b-3p	HITS-CLIP	19536157
MIRT724672	hsa-miR-6868-3p	HITS-CLIP	19536157
MIRT727100	hsa-miR-181a-5p	HITS-CLIP	22473208
MIRT727098	hsa-miR-181b-5p	HITS-CLIP	22473208
MIRT727099	hsa-miR-181c-5p	HITS-CLIP	22473208
MIRT727097	hsa-miR-181d-5p	HITS-CLIP	22473208
MIRT724679	hsa-miR-1250-3p	HITS-CLIP	19536157
MIRT724678	hsa-miR-153-5p	HITS-CLIP	19536157
MIRT724677	hsa-miR-205-5p	HITS-CLIP	19536157
MIRT724676	hsa-miR-4536-5p	HITS-CLIP	19536157
MIRT724675	hsa-miR-5696	HITS-CLIP	19536157
MIRT724674	hsa-miR-579-3p	HITS-CLIP	19536157
MIRT724673	hsa-miR-664b-3p	HITS-CLIP	19536157
MIRT724672	hsa-miR-6868-3p	HITS-CLIP	19536157
MIRT1175834	hsa-miR-105	CLIP-seq
MIRT1175835	hsa-miR-1299	CLIP-seq
MIRT1175836	hsa-miR-300	CLIP-seq
MIRT1175837	hsa-miR-369-3p	CLIP-seq
MIRT1175838	hsa-miR-374a	CLIP-seq
MIRT1175839	hsa-miR-374b	CLIP-seq
MIRT1175840	hsa-miR-374c	CLIP-seq
MIRT1175841	hsa-miR-378	CLIP-seq
MIRT1175842	hsa-miR-378b	CLIP-seq
MIRT1175843	hsa-miR-378c	CLIP-seq
MIRT1175844	hsa-miR-378d	CLIP-seq
MIRT1175845	hsa-miR-378e	CLIP-seq
MIRT1175846	hsa-miR-378f	CLIP-seq
MIRT1175847	hsa-miR-378h	CLIP-seq
MIRT1175848	hsa-miR-378i	CLIP-seq
MIRT1175849	hsa-miR-381	CLIP-seq
MIRT1175850	hsa-miR-422a	CLIP-seq
MIRT1175851	hsa-miR-4476	CLIP-seq
MIRT1175852	hsa-miR-4633-5p	CLIP-seq
MIRT1175853	hsa-miR-4638-3p	CLIP-seq
MIRT1175854	hsa-miR-4661-5p	CLIP-seq
MIRT1175855	hsa-miR-4666-3p	CLIP-seq
MIRT1175856	hsa-miR-4729	CLIP-seq
MIRT1175857	hsa-miR-4781-3p	CLIP-seq
MIRT1175858	hsa-miR-4782-5p	CLIP-seq
MIRT1175859	hsa-miR-514	CLIP-seq
MIRT1175860	hsa-miR-514b-3p	CLIP-seq
MIRT1175861	hsa-miR-516b	CLIP-seq
MIRT1175862	hsa-miR-550b	CLIP-seq
MIRT1175863	hsa-miR-646	CLIP-seq
MIRT1175864	hsa-miR-651	CLIP-seq
MIRT1175865	hsa-miR-655	CLIP-seq
MIRT2050949	hsa-miR-181a	CLIP-seq
MIRT2050950	hsa-miR-181b	CLIP-seq
MIRT2050951	hsa-miR-181c	CLIP-seq
MIRT2050952	hsa-miR-181d	CLIP-seq
MIRT2050953	hsa-miR-4261	CLIP-seq
MIRT2050954	hsa-miR-4262	CLIP-seq
MIRT2050955	hsa-miR-4719	CLIP-seq
MIRT2050956	hsa-miR-494	CLIP-seq
MIRT2050957	hsa-miR-513b	CLIP-seq
MIRT2050958	hsa-miR-543	CLIP-seq
MIRT2280010	hsa-miR-1276	CLIP-seq
MIRT2280011	hsa-miR-142-5p	CLIP-seq
MIRT2050949	hsa-miR-181a	CLIP-seq
MIRT2050950	hsa-miR-181b	CLIP-seq
MIRT2050951	hsa-miR-181c	CLIP-seq
MIRT2050952	hsa-miR-181d	CLIP-seq
MIRT2280012	hsa-miR-23a	CLIP-seq
MIRT2280013	hsa-miR-23b	CLIP-seq
MIRT2280014	hsa-miR-23c	CLIP-seq
MIRT1175836	hsa-miR-300	CLIP-seq
MIRT2280015	hsa-miR-3065-5p	CLIP-seq
MIRT2280016	hsa-miR-340	CLIP-seq
MIRT2280017	hsa-miR-3654	CLIP-seq
MIRT2280018	hsa-miR-3662	CLIP-seq
MIRT2280019	hsa-miR-375	CLIP-seq
MIRT1175849	hsa-miR-381	CLIP-seq
MIRT2280020	hsa-miR-3913-3p	CLIP-seq
MIRT2280021	hsa-miR-3920	CLIP-seq
MIRT2280022	hsa-miR-410	CLIP-seq
MIRT2050953	hsa-miR-4261	CLIP-seq
MIRT2050954	hsa-miR-4262	CLIP-seq
MIRT2280023	hsa-miR-4273	CLIP-seq
MIRT2280024	hsa-miR-4311	CLIP-seq
MIRT2280025	hsa-miR-4421	CLIP-seq
MIRT2280026	hsa-miR-4464	CLIP-seq
MIRT2280027	hsa-miR-4496	CLIP-seq
MIRT1175853	hsa-miR-4638-3p	CLIP-seq
MIRT1175855	hsa-miR-4666-3p	CLIP-seq
MIRT2280028	hsa-miR-4677-5p	CLIP-seq
MIRT2050955	hsa-miR-4719	CLIP-seq
MIRT2280029	hsa-miR-4748	CLIP-seq
MIRT2280030	hsa-miR-4762-3p	CLIP-seq
MIRT2050956	hsa-miR-494	CLIP-seq
MIRT2280031	hsa-miR-495	CLIP-seq
MIRT2050957	hsa-miR-513b	CLIP-seq
MIRT1175859	hsa-miR-514	CLIP-seq
MIRT1175860	hsa-miR-514b-3p	CLIP-seq
MIRT2050958	hsa-miR-543	CLIP-seq
MIRT2280032	hsa-miR-548c-3p	CLIP-seq
MIRT2280033	hsa-miR-583	CLIP-seq
MIRT2280034	hsa-miR-665	CLIP-seq
MIRT2454920	hsa-miR-1260	CLIP-seq
MIRT2454921	hsa-miR-1260b	CLIP-seq
MIRT1175835	hsa-miR-1299	CLIP-seq
MIRT2050949	hsa-miR-181a	CLIP-seq
MIRT2050950	hsa-miR-181b	CLIP-seq
MIRT2050951	hsa-miR-181c	CLIP-seq
MIRT2050952	hsa-miR-181d	CLIP-seq
MIRT2454922	hsa-miR-1827	CLIP-seq
MIRT2454923	hsa-miR-188-3p	CLIP-seq
MIRT2454924	hsa-miR-1972	CLIP-seq
MIRT2280012	hsa-miR-23a	CLIP-seq
MIRT2280013	hsa-miR-23b	CLIP-seq
MIRT2280014	hsa-miR-23c	CLIP-seq
MIRT1175836	hsa-miR-300	CLIP-seq
MIRT2454925	hsa-miR-3156-3p	CLIP-seq
MIRT2454926	hsa-miR-3168	CLIP-seq
MIRT2454927	hsa-miR-3190	CLIP-seq
MIRT1175837	hsa-miR-369-3p	CLIP-seq
MIRT1175838	hsa-miR-374a	CLIP-seq
MIRT1175839	hsa-miR-374b	CLIP-seq
MIRT1175840	hsa-miR-374c	CLIP-seq
MIRT1175841	hsa-miR-378	CLIP-seq
MIRT1175842	hsa-miR-378b	CLIP-seq
MIRT1175843	hsa-miR-378c	CLIP-seq
MIRT1175844	hsa-miR-378d	CLIP-seq
MIRT1175845	hsa-miR-378e	CLIP-seq
MIRT1175846	hsa-miR-378f	CLIP-seq
MIRT1175847	hsa-miR-378h	CLIP-seq
MIRT1175848	hsa-miR-378i	CLIP-seq
MIRT1175849	hsa-miR-381	CLIP-seq
MIRT2454928	hsa-miR-3908	CLIP-seq
MIRT2454929	hsa-miR-3924	CLIP-seq
MIRT2454930	hsa-miR-3926	CLIP-seq
MIRT2454931	hsa-miR-3938	CLIP-seq
MIRT2454932	hsa-miR-3942-5p	CLIP-seq
MIRT2454933	hsa-miR-3973	CLIP-seq
MIRT1175850	hsa-miR-422a	CLIP-seq
MIRT2050953	hsa-miR-4261	CLIP-seq
MIRT2050954	hsa-miR-4262	CLIP-seq
MIRT2454934	hsa-miR-4301	CLIP-seq
MIRT2454935	hsa-miR-4438	CLIP-seq
MIRT1175851	hsa-miR-4476	CLIP-seq
MIRT2280027	hsa-miR-4496	CLIP-seq
MIRT2454936	hsa-miR-4528	CLIP-seq
MIRT1175852	hsa-miR-4633-5p	CLIP-seq
MIRT1175853	hsa-miR-4638-3p	CLIP-seq
MIRT1175855	hsa-miR-4666-3p	CLIP-seq
MIRT2454937	hsa-miR-4703-5p	CLIP-seq
MIRT2050955	hsa-miR-4719	CLIP-seq
MIRT2454938	hsa-miR-4766-3p	CLIP-seq
MIRT1175858	hsa-miR-4782-5p	CLIP-seq
MIRT2454939	hsa-miR-4795-3p	CLIP-seq
MIRT2050956	hsa-miR-494	CLIP-seq
MIRT2454940	hsa-miR-5095	CLIP-seq
MIRT2050957	hsa-miR-513b	CLIP-seq
MIRT1175861	hsa-miR-516b	CLIP-seq
MIRT2050958	hsa-miR-543	CLIP-seq
MIRT2454941	hsa-miR-548a-5p	CLIP-seq
MIRT2454942	hsa-miR-548ab	CLIP-seq
MIRT2454943	hsa-miR-548ak	CLIP-seq
MIRT2454944	hsa-miR-548b-5p	CLIP-seq
MIRT2454945	hsa-miR-548c-5p	CLIP-seq
MIRT2454946	hsa-miR-548d-5p	CLIP-seq
MIRT2454947	hsa-miR-548h	CLIP-seq
MIRT2454948	hsa-miR-548i	CLIP-seq
MIRT2454949	hsa-miR-548j	CLIP-seq
MIRT2454950	hsa-miR-548w	CLIP-seq
MIRT2454951	hsa-miR-548y	CLIP-seq
MIRT2454952	hsa-miR-559	CLIP-seq
MIRT1175864	hsa-miR-651	CLIP-seq
MIRT1175865	hsa-miR-655	CLIP-seq
MIRT2454953	hsa-miR-656	CLIP-seq
MIRT2280034	hsa-miR-665	CLIP-seq
MIRT2454954	hsa-miR-671-5p	CLIP-seq
MIRT2454955	hsa-miR-922	CLIP-seq
MIRT2454956	hsa-miR-944	CLIP-seq
MIRT2280010	hsa-miR-1276	CLIP-seq
MIRT2578549	hsa-miR-1306	CLIP-seq
MIRT2280024	hsa-miR-4311	CLIP-seq
MIRT2280033	hsa-miR-583	CLIP-seq

Show/Hide all (27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000779	Component	Condensed chromosome, centromeric region	IEA
GO:0000793	Component	Condensed chromosome	IBA
GO:0000793	Component	Condensed chromosome	IEA
GO:0000794	Component	Condensed nuclear chromosome	IEA
GO:0000794	Component	Condensed nuclear chromosome	ISO
GO:0000796	Component	Condensin complex	IDA	11136719
GO:0000796	Component	Condensin complex	IEA
GO:0000796	Component	Condensin complex	NAS	17268547
GO:0005515	Function	Protein binding	IPI	12138188, 17268547, 24981860, 26496610, 28514442, 33961781, 35271311
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	10910072
GO:0005694	Component	Chromosome	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0007076	Process	Mitotic chromosome condensation	IBA
GO:0007076	Process	Mitotic chromosome condensation	IDA	11136719
GO:0007076	Process	Mitotic chromosome condensation	IEA
GO:0007076	Process	Mitotic chromosome condensation	NAS	10910072
GO:0016020	Component	Membrane	HDA	19946888
GO:0030261	Process	Chromosome condensation	IEA
GO:0051301	Process	Cell division	IEA
GO:0051984	Process	Positive regulation of chromosome segregation	IEA
GO:0051984	Process	Positive regulation of chromosome segregation	ISO
GO:1905820	Process	Positive regulation of chromosome separation	IEA
GO:1905820	Process	Positive regulation of chromosome separation	ISO
GO:1905821	Process	Positive regulation of chromosome condensation	IDA	17268547

MIM	HGNC	e!Ensembl
606280	24304	ENSG00000109805

Q9BPX3

Protein name

Condensin complex subunit 3 (Chromosome-associated protein G) (Condensin subunit CAP-G) (hCAP-G) (Melanoma antigen NY-MEL-3) (Non-SMC condensin I complex subunit G) (XCAP-G homolog)

Protein function

Regulatory subunit of the condensin complex, a complex required for conversion of interphase chromatin into mitotic-like condense chromosomes. The condensin complex probably introduces positive supercoils into relaxed DNA in the presence of type

PDB

6IGX

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF12719	Cnd3	559 → 859	Nuclear condensing complex subunits, C-term domain	Family

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in testis. {ECO:0000269|PubMed:10910072}.

Sequence

MGAERRLLSIKEAFRLAQQPHQNQAKLVVALSRTYRTMDDKTVFHEEFIHYLKYVMVVYK
REPAVERVIEFAAKFVTSFHQSDMEDDEEEEDGGLLNYLFTFLLKSHEANSNAVRFRVCL
LINKLLGSMPENAQIDDDVFDKINKAMLIRLKDKIPNVRIQAVLALSRLQDPKDDECPVV
NAYATLIENDSNPEVRRAVLSCIAPSAKTLPKIVGRTKDVKEAVRKLAYQVLAEKVHMRA
MSIAQRVMLLQQGLNDRSDAVKQAMQKHLLQGWLRFSEGNILELLHRLDVENSSEVAVSV
LNALFSITPLSELVGLCKNNDGRKLIPVETLTPEIALYWCALCEYLKSKGDEGEEFLEQI
LPEPVVYADYLLSYIQSIPVVNEEHRGDFSYIGNLMTKEFIGQQLILIIKSLDTSEEGGR
KKLLAVLQEILILPTIPISLVSFLVERLLHIIIDDNKRTQIVTEIISEIRAPIVTVGVNN
DPADVRKKELKMAEIKVKLIEAKEALENCITLQDFNRASELKEEIKALEDARINLLKETE
QLEIKEVHIEKNDAETLQKCLILCYELLKQMSISTGLSATMNGIIESLILPGIISIHPVV
RNLAVLCLGCCGLQNQDFARKHFVLLLQVLQIDDVTIKISALKAIFDQLMTFGIEPFKTK
KIKTLHCEGTEINSDDEQESKEVEETATAKNVLKLLSDFLDSEVSELRTGAAEGLAKLMF
SGLLVSSRILSRLILLWYNPVTEEDVQLRHCLGVFFPVFAYASRTNQECFEEAFLPTLQT
LANAPASSPLAEIDITNVAELLVDLTRPSGLNPQAKTSQDYQALTVHDNLAMKICNEILT
SPCSPEIRVYTKALSSLELSSHLAKDLLVLLNEILEQVKDRTCLRALEKIKIQLEKGNKE
FGDQAEAAQDATLTTTTFQNEDEKNKEVYMTPLRGVKATQASKSTQLKTNRGQRKVTVSA
RTNRRCQTAEADSESDHEVPEPESEMKMRLPRRAKTAALEKSKLNLAQFLNEDLS

Sequence length

1015

Interactions

View interactions

	Reactome
			Condensation of Prometaphase Chromosomes

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CARCINOMA, HEPATOCELLULAR	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (134)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	30806759		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Myeloid Leukemia (AML-M2)	Leukemia	CTD_human_DG	18206229		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Myeloid Leukemia, M1	Myeloid Leukemia	CTD_human_DG	18206229		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute recurrent pancreatitis	Pancreatitis	BEFREE	19844201		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	18709641		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	18709641		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	CTD_human_DG	19381893		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	30237740		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	30806759		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Hepatocellular Carcinoma	Liver carcinoma	BEFREE	29046167		★★★★★ ★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	22024702		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer disease, familial, type 3	Alzheimer disease	BEFREE	7683316		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	31701227		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	31152776		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	18980958		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	31152776		★★★★★ ★☆☆☆☆ Found in Text Mining only
ATRIAL SEPTAL DEFECT 1	Atrial Septal Defect	BEFREE	30284680		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Septal Defects	Atrial Septal Defect	BEFREE	30284680		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atypical Hemolytic Uremic Syndrome	Hemolytic Uremic Syndrome	BEFREE	16882452, 19459807, 21706448, 22622361, 23431077, 24005975, 30676336		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	31800155	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	30284680		★★★★★ ★☆☆☆☆ Found in Text Mining only
Azoospermia	Azoospermia	Pubtator	35219767	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	8552981		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	18059028, 29721098		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	24804218, 26757732, 28791367, 34272498, 34675265	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	8552981		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	24804218, 26663173, 36442414, 37553792	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Adenoid Cystic	Adenoid cystic carcinoma	Pubtator	37861550	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal Breast	Ductal carcinoma of breast	Pubtator	35186171	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	28737823	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	29843214, 30702595, 31746405, 34315286, 34919223, 35322101, 36317111, 37861550	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	35963640	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	29968393, 32626756, 33236143	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	35601741	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	33477943	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	24804218		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinosarcoma	Carcinoma	Pubtator	36186000	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Central Nervous System Neoplasms	Central Nervous System Neoplasms	BEFREE	19424665		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	30806759		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Hepatocellular Carcinoma	Liver carcinoma	BEFREE	29046167		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chromophobe Renal Cell Carcinoma	Chromophobe Carcinoma	CTD_human_DG	15108329		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	17261436, 23431077		★★★★★ ★☆☆☆☆ Found in Text Mining only
Collecting Duct Carcinoma of the Kidney	Renal Carcinoma	CTD_human_DG	15108329		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	35392038	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	29113183		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	30155403	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	35774271, 36442414	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	30967790		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	15108329		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	29609686		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	29609686		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	29609686		★★★★★ ★☆☆☆☆ Found in Text Mining only
DEAFNESS, AUTOSOMAL RECESSIVE (disorder)	Deafness	BEFREE	30284680		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	15389872, 16755236, 30690561		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	BEFREE	27986804		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	28790116		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	21305022, 36186000	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	33345608, 36072903	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Tremor	Tremor	BEFREE	31161314		★★★★★ ★☆☆☆☆ Found in Text Mining only
FRIEDREICH ATAXIA 1	Friedreich Ataxia	BEFREE	21370259		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	BEFREE	29307809		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	28692738		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	11300934, 29399702, 30356407, 36114444	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	26663173, 29399702, 31423196, 7891669		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	26663173	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	26663173, 29399702, 30356407, 31423196, 7891669		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	26663173, 29399702, 31423196		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	26663173, 36703644	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	29399702	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Block	Heart Block	BEFREE	8528226		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	30967790		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemolytic-Uremic Syndrome	Hemolytic Uremic Syndrome	BEFREE	14566051, 14615110, 16968692, 17261436, 17617869, 19190803		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	36046723	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	19439302		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	21908955	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	31774004		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	17261436, 23431077		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	CTD_human_DG	18206229		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	28284560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	29046167, 30089216, 31114379, 31802891		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	37861550	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	21908955	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	28433894		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	21908955, 33236143	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	34166375	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	18059028, 29721098		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	28790116		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	29046167		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	24804218		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	26634544, 27597974, 27923366		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	23782053, 30390708		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10910072, 23282028, 23782053, 29608247, 29721098		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	18059028, 18461482		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	10910072		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	17611626	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	37049604	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Motor Neuron Disease	Motor neuron disease	Pubtator	38001563	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	18237446	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucopolysaccharidoses	Mucopolysaccharidosis	Pubtator	32886284	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	36258216	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	37861550	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	18709641, 19424665, 23782053, 28790116, 28791367, 29046167, 29113183, 29938191		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	37834394	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	8964911		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	24804218		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	36186000	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	24804218, 34577856, 35186171	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	35986371	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	16847067, 35601741	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary Renal Cell Carcinoma	Papillary Renal Carcinoma	CTD_human_DG	15108329		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pelvic Organ Prolapse	Pelvic Organ Prolapse	BEFREE	28083713		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	25084203		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Neuropathy	Peripheral Neuropathy	BEFREE	25084203		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor B-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	28791367		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	26634544, 27597974, 27923366		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	26634544, 26979803, 27923366, 36245843, 36834602	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	15108329		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	21939398		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	30160204, 31713730		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	35126643	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcomatoid Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	15108329		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Erosion	Skin Erosion	BEFREE	30160204		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	18237446	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	23782053, 30390708		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	30390708, 37335105	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	BEFREE	29998824		★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	25658605		★★★★★ ★☆☆☆☆ Found in Text Mining only
TARSAL-CARPAL COALITION SYNDROME	Tarsal-Carpal Coalition Syndrome	BEFREE	31068979		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tendinitis	Tendinitis	BEFREE	29471516		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombotic Microangiopathies	Thrombotic Microangiopathies	BEFREE	16762990		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	31081967		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	32309867, 35685866	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	9920419	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

NCAPG (non-SMC condensin I complex subunit G)