SELENOW (selenoprotein W)

Gene

• Entrez ID: 6415
• Gene name: Selenoprotein W
• Gene symbol: SELENOW
• Synonyms (NCBI Gene): SEPW1, selW
• Chromosome: 19
• Chromosome location: 19q13.33
• Summary: This gene encodes a selenoprotein containing a selenocysteine (Sec) residue, which is encoded by the UGA codon that normally signals translation termination. The 3` UTRs of selenoprotein mRNAs contain a conserved stem-loop structure, the Sec insertion seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0006950	Process	Response to stress	IEA
GO:0010269	Process	Response to selenium ion	IBA
GO:0016209	Function	Antioxidant activity	IEA
GO:0030218	Process	Erythrocyte differentiation	IEA
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0098869	Process	Cellular oxidant detoxification	IEA

Other IDs

• MIM: 603235
• HGNC: 10752
• e!Ensembl: ENSG00000178980

Protein

• UniProt ID: P63302
• Protein name: Selenoprotein W (SelW)
• Protein function: Plays a role as a glutathione (GSH)-dependent antioxidant. May be involved in a redox-related process. May play a role in the myopathies of selenium deficiency (By similarity).
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF10262	Rdx	4 → 78	Rdx family	Family

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitously expressed with highest levels in skeletal muscle and heart, moderate levels in brain, spinal cord, thyroid, spleen, prostate, ovary, small intestine and colon, and lowest levels in liver and lymph node. {ECO:0000269|PubMed
• Sequence:

  MALAVRVVYCGAUGYKSKYLQLKKKLEDEFPGRLDICGEGTPQATGFFEVMVAGKLIHSK
  KKGDGYVDTESKFLKLVAAIKAALAQG

• Sequence length: 87

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
EPILEPSY	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Awakening Epilepsy	Epilepsy	CTD_human_DG	19499324		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	24278290, 30636640		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	26199857	Associate	★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	29742507		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	CTD_human_DG	19499324		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epilepsy	Epilepsy	Pubtator	39849427	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epilepsy, Cryptogenic	Epilepsy	CTD_human_DG	19499324		★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	BEFREE	19499324		★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	31781243		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	24278290, 30636640		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	30636640		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	19690192		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	19690192	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	29742507		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	31509445		★☆☆☆☆ Found in Text Mining only
Oligodendroglioma	Oligodendroglioma	Pubtator	29890994	Associate	★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	29742507		★☆☆☆☆ Found in Text Mining only