Gene Gene information from NCBI Gene database.
Entrez ID 641339
Gene name Zinc finger protein 674
Gene symbol ZNF674
Synonyms (NCBI Gene)
MRX92ZNF673B
Chromosome X
Chromosome location Xp11.3
Summary This gene encodes a zinc finger protein with an N-terminal Kruppel-associated box-containing (KRAB) domain and 11 Kruppel-type C2H2 zinc finger domains. Like other zinc finger proteins, this gene may function as a transcription factor. This gene resides o
miRNA miRNA information provided by mirtarbase database.
404
miRTarBase ID miRNA Experiments Reference
MIRT661557 hsa-miR-490-3p HITS-CLIP 22927820
MIRT661556 hsa-miR-3714 HITS-CLIP 22927820
MIRT661555 hsa-miR-34b-3p HITS-CLIP 22927820
MIRT661554 hsa-miR-619-3p HITS-CLIP 22927820
MIRT706159 hsa-miR-890 HITS-CLIP 22927820
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
12
GO ID Ontology Definition Evidence Reference
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0003677 Function DNA binding IEA
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
300573 17625 ENSG00000251192
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q2M3X9
Protein name Zinc finger protein 674
Protein function May be involved in transcriptional regulation.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01352 KRAB 7 48 KRAB box Family
PF00096 zf-C2H2 224 246 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 252 274 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 280 302 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 308 330 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 385 407 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 413 435 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 441 463 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 469 491 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 497 519 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 525 547 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 553 575 Zinc finger, C2H2 type Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in testis. {ECO:0000269|PubMed:16385466}.
Sequence
MAMSQESLTFKDVFVDFTLEEWQQLDSAQKNLYRDVMLENYSHLVSVGHLVGKPDVIFRL
GPGDESWMADGGTPVRTCAGEDRPEVWEVDEQIDHYKESQDKFLWQAAFIGKETLKDESG
QECKICRKIIYLNTDFVSVKQRLPKYYSWERCSKHHLNFLGQNRSYVRKKDDGCKAYWKV
CLHYNLHKAQPAERFFDPNQRGKALHQKQALRKSQRSQTGEKLYKCTECGKVFIQKANLV
VHQRTH
TGEKPYECCECAKAFSQKSTLIAHQRTHTGEKPYECSECGKTFIQKSTLIKHQR
TH
TGEKPFVCDKCPKAFKSSYHLIRHEKTHIRQAFYKGIKCTTSSLIYQRIHTSEKPQCS
EHGKASDEKPSPTKHWRTHTKENIYECSKCGKSFRGKSHLSVHQRIHTGEKPYECSICGK
TFSGKSHLSVHHRTH
TGEKPYECRRCGKAFGEKSTLIVHQRMHTGEKPYKCNECGKAFSE
KSPLIKHQRIH
TGERPYECTDCKKAFSRKSTLIKHQRIHTGEKPYKCSECGKAFSVKSTL
IVHHRTH
TGEKPYECRDCGKAFSGKSTLIKHQRSHTGDKNL
Sequence length 581
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
9
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Acute myeloid leukemia - ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
History of neurodevelopmental disorder Conflicting classifications of pathogenicity ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
INTELLECTUAL DEVELOPMENTAL DISORDER, X-LINKED Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
INTELLECTUAL DISABILITY Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Autistic Disorder Autism BEFREE 19160128
★☆☆☆☆
Found in Text Mining only
Carcinoma Hepatocellular Hepatocellular carcinoma Pubtator 27896271 Associate
★☆☆☆☆
Found in Text Mining only
Glioma Glioma Pubtator 30984540 Associate
★☆☆☆☆
Found in Text Mining only
Intellectual Disability Mental retardation BEFREE 19160128, 20186789, 22126752
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Intellectual Disability Intellectual developmental disorder Pubtator 22126752, 23871722 Associate
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Mental Retardation Mental retardation BEFREE 19160128, 20186789
★☆☆☆☆
Found in Text Mining only
Mental Retardation, X-Linked Mental retardation BEFREE 16385466
★☆☆☆☆
Found in Text Mining only
Mental Retardation, X-Linked Mental retardation LHGDN 16385466
★☆☆☆☆
Found in Text Mining only
Mental Retardation, X-Linked Mental retardation CTD_human_DG 16385466
★☆☆☆☆
Found in Text Mining only
Mental Retardation, X-Linked Mental retardation GENOMICS_ENGLAND_DG 23871722
★☆☆☆☆
Found in Text Mining only