TINAGL1 (tubulointerstitial nephritis antigen like 1)

Gene

• Entrez ID: 64129
• Gene name: Tubulointerstitial nephritis antigen like 1
• Gene symbol: TINAGL1
• Synonyms (NCBI Gene): ARG1, LCN7, LIECG3, TINAGRP
• Chromosome: 1
• Chromosome location: 1p35.2
• Summary: The protein encoded by this gene is similar in sequence to tubulointerstitial nephritis antigen, a secreted glycoprotein that is recognized by antibodies in some types of immune-related tubulointerstitial nephritis. Three transcript variants encoding diff

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1425436	hsa-miR-1225-3p	CLIP-seq
MIRT1425437	hsa-miR-1233	CLIP-seq
MIRT1425438	hsa-miR-1285	CLIP-seq
MIRT1425439	hsa-miR-1471	CLIP-seq
MIRT1425440	hsa-miR-1827	CLIP-seq
MIRT1425441	hsa-miR-3122	CLIP-seq
MIRT1425442	hsa-miR-3145-5p	CLIP-seq
MIRT1425443	hsa-miR-3187-5p	CLIP-seq
MIRT1425444	hsa-miR-3612	CLIP-seq
MIRT1425445	hsa-miR-3665	CLIP-seq
MIRT1425446	hsa-miR-3689a-3p	CLIP-seq
MIRT1425447	hsa-miR-3689c	CLIP-seq
MIRT1425448	hsa-miR-3913-5p	CLIP-seq
MIRT1425449	hsa-miR-4252	CLIP-seq
MIRT1425450	hsa-miR-4433	CLIP-seq
MIRT1425451	hsa-miR-4640-5p	CLIP-seq
MIRT1425452	hsa-miR-4707-3p	CLIP-seq
MIRT1425453	hsa-miR-4726-5p	CLIP-seq
MIRT1425454	hsa-miR-4728-5p	CLIP-seq
MIRT1425455	hsa-miR-4736	CLIP-seq
MIRT1425456	hsa-miR-4785	CLIP-seq
MIRT1425457	hsa-miR-4793-3p	CLIP-seq
MIRT1425458	hsa-miR-4800-5p	CLIP-seq
MIRT1425459	hsa-miR-490-3p	CLIP-seq
MIRT1425460	hsa-miR-582-5p	CLIP-seq
MIRT1425461	hsa-miR-612	CLIP-seq
MIRT1425462	hsa-miR-650	CLIP-seq
MIRT1425463	hsa-miR-658	CLIP-seq
MIRT1425464	hsa-miR-665	CLIP-seq
MIRT1425465	hsa-miR-940	CLIP-seq
MIRT1425466	hsa-miR-10a	CLIP-seq
MIRT1425467	hsa-miR-10b	CLIP-seq
MIRT1425436	hsa-miR-1225-3p	CLIP-seq
MIRT1425437	hsa-miR-1233	CLIP-seq
MIRT1425468	hsa-miR-128	CLIP-seq
MIRT1425438	hsa-miR-1285	CLIP-seq
MIRT1425469	hsa-miR-2114	CLIP-seq
MIRT1425470	hsa-miR-24	CLIP-seq
MIRT1425443	hsa-miR-3187-5p	CLIP-seq
MIRT1425471	hsa-miR-339-5p	CLIP-seq
MIRT1425472	hsa-miR-3667-5p	CLIP-seq
MIRT1425446	hsa-miR-3689a-3p	CLIP-seq
MIRT1425447	hsa-miR-3689c	CLIP-seq
MIRT1425473	hsa-miR-3929	CLIP-seq
MIRT1425474	hsa-miR-4284	CLIP-seq
MIRT1425475	hsa-miR-4419b	CLIP-seq
MIRT1425476	hsa-miR-4421	CLIP-seq
MIRT1425450	hsa-miR-4433	CLIP-seq
MIRT1425477	hsa-miR-4446-3p	CLIP-seq
MIRT1425478	hsa-miR-4478	CLIP-seq
MIRT1425479	hsa-miR-4492	CLIP-seq
MIRT1425480	hsa-miR-4498	CLIP-seq
MIRT1425481	hsa-miR-4505	CLIP-seq
MIRT1425482	hsa-miR-451b	CLIP-seq
MIRT1425483	hsa-miR-4696	CLIP-seq
MIRT1425484	hsa-miR-4725-5p	CLIP-seq
MIRT1425454	hsa-miR-4728-5p	CLIP-seq
MIRT1425485	hsa-miR-4763-5p	CLIP-seq
MIRT1425486	hsa-miR-4786-5p	CLIP-seq
MIRT1425487	hsa-miR-485-5p	CLIP-seq
MIRT1425488	hsa-miR-504	CLIP-seq
MIRT1425461	hsa-miR-612	CLIP-seq
MIRT1425489	hsa-miR-661	CLIP-seq
MIRT1425464	hsa-miR-665	CLIP-seq
MIRT1425490	hsa-miR-762	CLIP-seq
MIRT1425491	hsa-miR-769-5p	CLIP-seq
MIRT1425468	hsa-miR-128	CLIP-seq
MIRT1425438	hsa-miR-1285	CLIP-seq
MIRT1425469	hsa-miR-2114	CLIP-seq
MIRT1425443	hsa-miR-3187-5p	CLIP-seq
MIRT2127508	hsa-miR-3614-5p	CLIP-seq
MIRT1425473	hsa-miR-3929	CLIP-seq
MIRT1425475	hsa-miR-4419b	CLIP-seq
MIRT1425450	hsa-miR-4433	CLIP-seq
MIRT1425478	hsa-miR-4478	CLIP-seq
MIRT2127509	hsa-miR-4662a-5p	CLIP-seq
MIRT2127510	hsa-miR-4676-5p	CLIP-seq
MIRT1425486	hsa-miR-4786-5p	CLIP-seq
MIRT1425487	hsa-miR-485-5p	CLIP-seq
MIRT2127511	hsa-miR-575	CLIP-seq
MIRT1425461	hsa-miR-612	CLIP-seq
MIRT1425489	hsa-miR-661	CLIP-seq
MIRT1425464	hsa-miR-665	CLIP-seq
MIRT1425469	hsa-miR-2114	CLIP-seq
MIRT1425446	hsa-miR-3689a-3p	CLIP-seq
MIRT1425447	hsa-miR-3689c	CLIP-seq
MIRT1425473	hsa-miR-3929	CLIP-seq
MIRT1425475	hsa-miR-4419b	CLIP-seq
MIRT1425478	hsa-miR-4478	CLIP-seq
MIRT1425454	hsa-miR-4728-5p	CLIP-seq
MIRT1425487	hsa-miR-485-5p	CLIP-seq
MIRT1425489	hsa-miR-661	CLIP-seq
MIRT1425466	hsa-miR-10a	CLIP-seq
MIRT1425467	hsa-miR-10b	CLIP-seq
MIRT1425469	hsa-miR-2114	CLIP-seq
MIRT2642634	hsa-miR-323-5p	CLIP-seq
MIRT1425471	hsa-miR-339-5p	CLIP-seq
MIRT2642635	hsa-miR-3613-3p	CLIP-seq
MIRT1425472	hsa-miR-3667-5p	CLIP-seq
MIRT1425473	hsa-miR-3929	CLIP-seq
MIRT2642636	hsa-miR-3934	CLIP-seq
MIRT1425475	hsa-miR-4419b	CLIP-seq
MIRT1425476	hsa-miR-4421	CLIP-seq
MIRT1425478	hsa-miR-4478	CLIP-seq
MIRT2127509	hsa-miR-4662a-5p	CLIP-seq
MIRT2127510	hsa-miR-4676-5p	CLIP-seq
MIRT1425484	hsa-miR-4725-5p	CLIP-seq
MIRT1425486	hsa-miR-4786-5p	CLIP-seq
MIRT1425487	hsa-miR-485-5p	CLIP-seq
MIRT1425488	hsa-miR-504	CLIP-seq
MIRT2642637	hsa-miR-520d-5p	CLIP-seq
MIRT2642638	hsa-miR-524-5p	CLIP-seq
MIRT2127511	hsa-miR-575	CLIP-seq
MIRT1425491	hsa-miR-769-5p	CLIP-seq
MIRT2642639	hsa-miR-876-3p	CLIP-seq
MIRT1425466	hsa-miR-10a	CLIP-seq
MIRT1425467	hsa-miR-10b	CLIP-seq
MIRT1425471	hsa-miR-339-5p	CLIP-seq
MIRT1425472	hsa-miR-3667-5p	CLIP-seq
MIRT1425476	hsa-miR-4421	CLIP-seq
MIRT1425482	hsa-miR-451b	CLIP-seq
MIRT2127509	hsa-miR-4662a-5p	CLIP-seq
MIRT2127510	hsa-miR-4676-5p	CLIP-seq
MIRT1425483	hsa-miR-4696	CLIP-seq
MIRT1425484	hsa-miR-4725-5p	CLIP-seq
MIRT1425488	hsa-miR-504	CLIP-seq
MIRT2127511	hsa-miR-575	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005201	Function	Extracellular matrix structural constituent	NAS	11170462
GO:0005201	Function	Extracellular matrix structural constituent	RCA	20551380, 23979707, 25037231, 27068509, 27559042, 28675934
GO:0005515	Function	Protein binding	IPI	25416956, 32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	NAS	11170462
GO:0005615	Component	Extracellular space	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005764	Component	Lysosome	IBA
GO:0006508	Process	Proteolysis	IDA	11170462
GO:0008234	Function	Cysteine-type peptidase activity	IDA	11170462
GO:0016197	Process	Endosomal transport	TAS	10799322
GO:0031012	Component	Extracellular matrix	HDA	20551380
GO:0031012	Component	Extracellular matrix	HDA	23979707, 25037231, 27068509, 27559042, 28675934
GO:0043236	Function	Laminin binding	IEA
GO:0070062	Component	Extracellular exosome	HDA	19199708

Other IDs

• MIM: 616064
• HGNC: 19168
• e!Ensembl: ENSG00000142910

Protein

• UniProt ID: Q9GZM7
• Protein name: Tubulointerstitial nephritis antigen-like (Glucocorticoid-inducible protein 5) (Oxidized LDL-responsive gene 2 protein) (OLRG-2) (Tubulointerstitial nephritis antigen-related protein) (TIN Ag-related protein) (TIN-Ag-RP)
• Protein function: May be implicated in the adrenocortical zonation and in mechanisms for repressing the CYP11B1 gene expression in adrenocortical cells. This is a non catalytic peptidase C1 family protein (By similarity).
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00112	Peptidase_C1	203 → 456	Papain family cysteine protease	Domain

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in aorta, heart, placenta, kidney and a colorectal adenocarcinoma cell line. Moderately expressed in skeletal muscle, pancreas, lung, lymph nodes, adrenal gland, bone marrow and thyroid. Weakly expressed in colon, smal
• Sequence:

  MWRCPLGLLLLLPLAGHLALGAQQGRGRRELAPGLHLRGIRDAGGRYCQEQDLCCRGRAD
  DCALPYLGAICYCDLFCNRTVSDCCPDFWDFCLGVPPPFPPIQGCMHGGRIYPVLGTYWD
  NCNRCTCQENRQWQCDQEPCLVDPDMIKAINQGNYGWQAGNHSAFWGMTLDEGIRYRLGT
  IRPSSSVMNMHEIYTVLNPGEVLPTAFEASEKWPNLIHEPLDQGNCAGSWAFSTAAVASD
  RVSIHSLGHMTPVLSPQNLLSCDTHQQQGCRGGRLDGAWWFLRRRGVVSDHCYPFSGRER
  DEAGPAPPCMMHSRAMGRGKRQATAHCPNSYVNNNDIYQVTPVYRLGSNDKEIMKELMEN
  GPVQALMEVHEDFFLYKGGIYSHTPVSLGRPERYRRHGTHSVKITGWGEETLPDGRTLKY
  WTAANSWGPAWGERGHFRIVRGVNECDIESFVLGVWGRVGMEDMGHH

• Sequence length: 467

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Cerebrovascular Accidents	Stroke	BEFREE	30112629		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	27137985		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	CTD_human_DG	27602772		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	30728077		★☆☆☆☆ Found in Text Mining only
Amino Acid Metabolism, Inborn Errors	Disorder of amino acid metabolism	CTD_human_DG	21239484		★☆☆☆☆ Found in Text Mining only
Amino Acid Metabolism, Inherited Disorders	Inherited Errors of Amino Acid Metabolism	CTD_human_DG	21239484		★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	29559907, 29668503		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	29408267		★☆☆☆☆ Found in Text Mining only
Androgen-Insensitivity Syndrome	Androgen-Insensitivity Syndrome	BEFREE	26515089		★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	27274608		★☆☆☆☆ Found in Text Mining only
Anorexia	Anorexia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	30792060		★☆☆☆☆ Found in Text Mining only
Argininemia	Argininemia	Orphanet			★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	17369504, 22194622, 23375628, 27998825, 29098611		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	30887278, 30990796		★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	34480465	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	12507903	Stimulate	★☆☆☆☆ Found in Text Mining only
Asbestosis	Asbestosis	CTD_human_DG	26699812		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	12813015, 16387594, 18617639, 19281908, 20124949, 20851928, 21512169, 22472724, 24150243, 30381539		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	16387594, 18617639, 20851928, 21512169, 30381539, 38245772	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	LHGDN	18617639		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	CTD_human_DG	19281908, 19800904		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	19281908	Inhibit	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	17369504, 22194622, 23375628, 27998825, 29098611		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	17369504	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Chronic Hepatitis	Autoimmune hepatitis	LHGDN	11750286		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	30797943		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	24636145, 29394243		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	29970307		★☆☆☆☆ Found in Text Mining only
Brain Injuries Diffuse	Brain injuries	Pubtator	36894313	Associate	★☆☆☆☆ Found in Text Mining only
Brain Injuries Traumatic	Brain injuries	Pubtator	28222567	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	16245302, 28810691		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	26061397, 28283696, 36229542	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	31552680	Stimulate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	36949762	Inhibit	★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	24919409		★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary dysplasia	Pubtator	24919409, 27895230, 30267614	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	29883780, 29970307		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	20661013, 22298472, 22434791, 25577247, 30557986, 32118719, 32476791, 37249521, 37530240, 39528951, 40189907	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	30320132	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	22951905, 37839873	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	27287545, 31764771	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	31764771		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	24763700, 25245031, 30526064		★☆☆☆☆ Found in Text Mining only
CATARACT, ANTERIOR POLAR	Cataract	BEFREE	29968707		★☆☆☆☆ Found in Text Mining only
Cerebellar Hypoplasia	Cerebellar hypoplasia	Pubtator	36305856	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	26515089, 40696650	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Palsy	Cerebral palsy	Pubtator	32769929	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	26515089, 31619589, 31756041		★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	BEFREE	16387594, 19281908, 20124949		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	26969740		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	32118719, 34715880, 37249521	Associate	★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	Pubtator	37993261	Associate	★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	30228936		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	27104830	Inhibit	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	27683110, 31088266		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	29970307, 30108309, 30890279		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	12115381		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	26759006, 37530327, 38369188	Associate	★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	24486397		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	19201693		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	30526064		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	28760552, 30526064		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	33731531	Stimulate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	19303401, 30526064		★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	27243669, 31683763		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	31358861		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	25926674, 35954202	Associate	★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	29741792		★☆☆☆☆ Found in Text Mining only
Dejerine-Sottas Disease (disorder)	Charcot-Marie-Tooth disease	BEFREE	26090422		★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	28747341		★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	21211653	Inhibit	★☆☆☆☆ Found in Text Mining only
Dermatitis, Allergic Contact	Dermatitis	BEFREE	28747341		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	29673160, 29967177, 31015037		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	GWASCAT_DG	31451708		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	21217072, 38255949	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	29673160, 29967177, 31015037		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	GWASCAT_DG	31451708		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	34560403	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASCAT_DG	30054458		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	30092954, 30233283		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	28446459		★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	BEFREE	30206632		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	24658839	Stimulate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	30375700		★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	31708913		★☆☆☆☆ Found in Text Mining only
Erectile dysfunction	Erectile Dysfunction	BEFREE	26537638		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	25144454		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	23082063, 31960110	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	25144454		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	25144454	Stimulate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	36921563, 37839637	Associate	★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	29756997		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	26123990		★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	BEFREE	31320834		★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	Pubtator	31320834	Associate	★☆☆☆☆ Found in Text Mining only
Gastroparesis	Gastroparesis	BEFREE	29501441		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	28259657		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	32498400	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	28259657		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	27287871, 31195027	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	28107450	Stimulate	★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	HPO_DG			★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	21040785		★☆☆☆☆ Found in Text Mining only
Hair Diseases	Hair Diseases	CTD_human_DG	21239484		★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	28268114		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	24486397		★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	Pubtator	24489574	Associate	★☆☆☆☆ Found in Text Mining only
Hemiplegia/hemiparesis	Hemiplegia/hemiparesis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	17098461		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	27637084	Associate	★☆☆☆☆ Found in Text Mining only
Hyperargininemia	Hyperbilirubinemia	Pubtator	21802329, 29443755, 32769929, 36722221	Associate	★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	29048462		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	28835451, 30151392, 31150695		★☆☆☆☆ Found in Text Mining only
Hypersensitivity Delayed	Hypersensitivity	Pubtator	36911725	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension Pulmonary	Pulmonary hypertension	Pubtator	24919409, 27895230, 30267614	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	LHGDN	17347269		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	24763700, 24919409, 27432976, 28248201, 30267614		★☆☆☆☆ Found in Text Mining only
Ichthyosis Lamellar	Lamellar ichthyosis	Pubtator	26061397	Stimulate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	16709958		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	33604393, 38086271	Associate	★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	CTD_human_DG	21239484		★☆☆☆☆ Found in Text Mining only
Inborn Errors of Metabolism	Inborn Errors Of Metabolism	BEFREE	24997092		★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	28747341		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	HPO_DG			★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	25353287		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	26515089, 30112629		★☆☆☆☆ Found in Text Mining only
Ischemic Stroke	Ischemic stroke	Pubtator	26515089	Associate	★☆☆☆☆ Found in Text Mining only
Juvenile Myelomonocytic Leukemia	Myelomonocytic Leukemia	BEFREE	29227812		★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	Pubtator	35552484	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	36960055	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	36212177	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	30333625		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelomonocytic, Chronic	Myelomonocytic Leukemia	BEFREE	29227812		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	19253371, 20050660, 25353287, 25577247, 26969740, 27137985, 28970136, 29187023, 29883780, 30320132, 30557986, 30697069, 31792727		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis, Alcoholic	Alcoholic Liver Cirrhosis	BEFREE	30585398		★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	BEFREE	29961243		★☆☆☆☆ Found in Text Mining only
Liver Neoplasms	Liver neoplasm	Pubtator	30176945	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	37809107	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	38086271	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	38302188	Stimulate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	31552680	Stimulate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	38007577	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	37839873	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Extranodal NK-T-Cell	Lymphoma	BEFREE	26497849		★☆☆☆☆ Found in Text Mining only
Lymphoma, Large-Cell, Follicular	Lymphoma	BEFREE	21063024		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	21063024		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	21063024		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	16245302, 28810691		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	25144454		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	28808255		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	20711410		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	28000845		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	17023580, 20050660, 22001609, 23017138, 29227812, 29254508, 29363180, 29914893, 29970307, 30429607, 30605863, 31690955		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	27683110, 31088266		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	20050660, 29363180, 29399404		★☆☆☆☆ Found in Text Mining only
Mental impairment	Mental Depression	BEFREE	17997338, 26467175		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	17997338		★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	BEFREE	30199767		★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	Pubtator	30199767	Associate	★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	37837870, 38427757	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	29707981		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	27704281, 28130499		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	34025661	Associate	★☆☆☆☆ Found in Text Mining only
Multiple System Atrophy	Multiple system atrophy	Pubtator	29850876	Associate	★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia gravis	Pubtator	37414259	Associate	★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	29227812		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	15147372, 37366304	Associate	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	25014230		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	17369504, 19896478, 26438688		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	LHGDN	17369504		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	17369504, 25469788, 31772617	Associate	★☆☆☆☆ Found in Text Mining only
Myopathy	Myopathy	CTD_human_DG	21239484		★☆☆☆☆ Found in Text Mining only
Necrotizing enterocolitis in fetus OR newborn	Necrotizing Enterocolitis	BEFREE	26895666		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	20050660, 20856806, 22145026, 23017138, 24651438, 24998851, 25437558, 25577247, 26514486, 26754935, 27936099, 28008146, 28101568, 28259657, 28680747, 28807001, 28830617, 28904063, 28970136, 29166611, 29254508, 29340095, 29399404, 29410946, 29507420, 29722542, 29892522, 29970307, 30352911, 30414862, 30429607, 30528455, 30595215, 30697069, 30808864, 30886438, 30890279, 30943407, 31278254, 31646104, 31690955, 31783150, 31792727		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	25437558, 26161395		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	25961062, 26161395	Associate	★☆☆☆☆ Found in Text Mining only
Non-Convulsive Status Epilepticus	Nonconvulsive status epilepticus	BEFREE	29961243		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	19431148, 23850196, 25521548, 28101568, 30956278		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	GWASDB_DG	21552555		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	GWASCAT_DG	21552555		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	22189190, 27233965, 28808255, 28835451, 29098611		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	32313729	Stimulate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	32925767	Associate	★☆☆☆☆ Found in Text Mining only
Osteomyelitis	Osteomyelitis	BEFREE	30711175		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	28808255		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	28344866, 28808255		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	21347333, 22434791, 24741628	Associate	★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic disorder	Pubtator	35105872	Associate	★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	Pubtator	39712018	Inhibit	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	28769786		★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	28808255		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Diseases	Polycystic kidney disease	BEFREE	30042193		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	BEFREE	30042193		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	29055959	Associate	★☆☆☆☆ Found in Text Mining only
Portal Vein Thrombosis	Portal Vein Thrombosis	BEFREE	28785178		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	20711410		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	20711410	Associate	★☆☆☆☆ Found in Text Mining only
Pseudohyperkalemia Cardiff	Pseudohyperkalemia Cardiff	BEFREE	24552712		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	12507903		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	12507903	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	33604393	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	17934065		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary fibrosis	Pubtator	38302188	Associate	★☆☆☆☆ Found in Text Mining only
Renal carnitine transport defect	Renal Carnitine Transport Defect	BEFREE	27274608		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	19201693		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	22682473, 23126644, 30887278		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	21356378	Associate	★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	31484735, 35720398, 37261353	Associate	★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	28146645, 31844996		★☆☆☆☆ Found in Text Mining only
Severe intellectual disability	Mental retardation	HPO_DG			★☆☆☆☆ Found in Text Mining only
Sex Differentiation Disorders	Sex Differentiation Disorders	BEFREE	29423011		★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	12507903, 26061397, 34669971	Associate	★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	30665936		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	15685238		★☆☆☆☆ Found in Text Mining only
Spastic Paraplegia	Spastic Paraplegia	BEFREE	26123990		★☆☆☆☆ Found in Text Mining only
Speech Disorders	Speech Disorders	HPO_DG			★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	26514486, 32092078	Stimulate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	26514486		★☆☆☆☆ Found in Text Mining only
Stable angina	Stable Angina	BEFREE	25591771		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	24741632	Stimulate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	32415175	Associate	★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	26515089	Associate	★☆☆☆☆ Found in Text Mining only
Tauopathies	Tauopathies	BEFREE	26538654		★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	28000845		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	28000845		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	30612941		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	36229542	Inhibit	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	40613791	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	27104830		★☆☆☆☆ Found in Text Mining only
Uremia	Uremia	BEFREE	31777959		★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	BEFREE	29752572		★☆☆☆☆ Found in Text Mining only
Van der Woude syndrome	Van Der Woude Syndrome	BEFREE	29968707		★☆☆☆☆ Found in Text Mining only