ADGRL4 (adhesion G protein-coupled receptor L4)

Gene

• Entrez ID: 64123
• Gene name: Adhesion G protein-coupled receptor L4
• Gene symbol: ADGRL4
• Synonyms (NCBI Gene): ELTD1, ETL, KPG_003
• Chromosome: 1
• Chromosome location: 1p31.1

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT731784	hsa-miR-139-5p	Luciferase reporter assay, Western blot	26449464
MIRT731784	hsa-miR-139-5p	Luciferase reporter assay, Western blot	26449464
MIRT731784	hsa-miR-139-5p	Luciferase reporter assay, Western blot	26449464
MIRT742248	hsa-miR-3689d	HITS-CLIP	23824327
MIRT742249	hsa-miR-6851-5p	HITS-CLIP	23824327
MIRT742250	hsa-miR-7847-3p	HITS-CLIP	23824327
MIRT742251	hsa-miR-6833-5p	HITS-CLIP	23824327
MIRT742252	hsa-miR-4752	HITS-CLIP	23824327
MIRT742253	hsa-miR-1305	HITS-CLIP	23824327
MIRT742254	hsa-miR-335-3p	HITS-CLIP	23824327

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004888	Function	Transmembrane signaling receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	IBA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	TAS	15203201
GO:0005509	Function	Calcium ion binding	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0007165	Process	Signal transduction	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	15203201
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	15203201
GO:0031410	Component	Cytoplasmic vesicle	ISS

Other IDs

• MIM: 616419
• HGNC: 20822
• e!Ensembl: ENSG00000162618

Protein

• UniProt ID: Q9HBW9
• Protein name: Adhesion G protein-coupled receptor L4 (EGF, latrophilin and seven transmembrane domain-containing protein 1) (EGF-TM7-latrophilin-related protein) (ETL protein)
• Protein function: Endothelial orphan receptor that acts as a key regulator of angiogenesis.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07645	EGF_CA	58 → 107	Calcium-binding EGF domain	Domain
  PF16489	GAIN	138 → 342	GPCR-Autoproteolysis INducing (GAIN) domain	Domain
  PF01825	GPS	368 → 412	GPCR proteolysis site, GPS, motif	Motif
  PF00002	7tm_2	424 → 660	7 transmembrane receptor (Secretin family)	Family

• Tissue specificity: TISSUE SPECIFICITY: Detected in the majority of epithelial cells in tumor and normal tissues. Expressed also in human umbilical vein endothelial cells. {ECO:0000269|PubMed:23871637}.
• Sequence:

  MKRLPLLVVFSTLLNCSYTQNCTKTPCLPNAKCEIRNGIEACYCNMGFSGNGVTICEDDN
  ECGNLTQSCGENANCTNTEGSYYCMCVPGFRSSSNQDRFITNDGTVCIENVNANCHLDNV
  CIAANINKTLTKIRSIKEPVALLQEVYRNSVTDLSPTDIITYIEILAESSSLLGYKNNTI
  SAKDTLSNSTLTEFVKTVNNFVQRDTFVVWDKLSVNHRRTHLTKLMHTVEQATLRISQSF
  QKTTEFDTNSTDIALKVFFFDSYNMKHIHPHMNMDGDYINIFPKRKAAYDSNGNVAVAFV
  YYKSIGPLLSSSDNFLLKPQNYDNSEEEERVISSVISVSMSSNPPTLYELEKITFTLSHR
  KVTDRYRSLCAFWNYSPDTMNGSWSSEGCELTYSNETHTSCRCNHLTHFAILMSSGPSIG
  IKDYNILTRITQLGIIISLICLAICIFTFWFFSEIQSTRTTIHKNLCCSLFLAELVFLVG
  INTNTNKLFCSIIAGLLHYFFLAAFAWMCIEGIHLYLIVVGVIYNKGFLHKNFYIFGYLS
  PAVVVGFSAALGYRYYGTTKVCWLSTENNFIWSFIGPACLIILVNLLAFGVIIYKVFRHT
  AGLKPEVSCFENIRSCARGALALLFLLGTTWIFGVLHVVHASVVTAYLFTVSNAFQGMFI
  FLFLCVLSRKIQEEYYRLFKNVPCCFGCLR

• Sequence length: 690

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ANOREXIA NERVOSA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANNABIS USE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EATING DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GENERALIZED ANXIETY DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Atherosclerosis	Atherosclerosis	Pubtator	7881755	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	38287102	Associate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	23388545	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	27609023	Associate	★☆☆☆☆ Found in Text Mining only
Cushing's symphalangism	Proximal symphalangism	Pubtator	7881755	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	26449464, 29890994		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	29890994	Stimulate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	26449464, 29890994		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	23096411, 27416955, 31554859		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	31554859	Associate	★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	23474535		★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	22606234		★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	7881755	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure	Kidney Failure	BEFREE	28806758		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	32321460	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	30026838		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	30026838, 31554859		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	23096411, 23871637, 27416955, 30026838, 31775252		★☆☆☆☆ Found in Text Mining only
Oligodendroglioma	Oligodendroglioma	Pubtator	29890994	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	39224598	Associate	★☆☆☆☆ Found in Text Mining only