Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	64122
Gene name	Fructosamine 3 kinase
Gene symbol	FN3K
Synonyms (NCBI Gene)	-
Chromosome	17
Chromosome location	17q25.3
Summary	A high concentration of glucose can result in non-enzymatic oxidation of proteins by reaction of glucose and lysine residues (glycation). Proteins modified in this way, fructosamines, are less active or functional. This gene encodes an enzyme which cataly

199

Show/Hide all (199)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016932	hsa-miR-335-5p	Microarray	18185580
MIRT490110	hsa-miR-483-5p	PAR-CLIP	20371350
MIRT490140	hsa-miR-4802-5p	PAR-CLIP	20371350
MIRT490106	hsa-miR-6871-5p	PAR-CLIP	20371350
MIRT490132	hsa-miR-542-5p	PAR-CLIP	20371350
MIRT490138	hsa-miR-4534	PAR-CLIP	20371350
MIRT490137	hsa-miR-8082	PAR-CLIP	20371350
MIRT569953	hsa-miR-139-3p	PAR-CLIP	20371350
MIRT569952	hsa-miR-766-5p	PAR-CLIP	20371350
MIRT569951	hsa-miR-7154-3p	PAR-CLIP	20371350
MIRT569950	hsa-miR-765	PAR-CLIP	20371350
MIRT569949	hsa-miR-6894-5p	PAR-CLIP	20371350
MIRT490100	hsa-miR-6717-5p	PAR-CLIP	20371350
MIRT490097	hsa-miR-6878-5p	PAR-CLIP	20371350
MIRT490096	hsa-miR-6731-5p	PAR-CLIP	20371350
MIRT490095	hsa-miR-8085	PAR-CLIP	20371350
MIRT490087	hsa-miR-30c-1-3p	PAR-CLIP	20371350
MIRT490086	hsa-miR-30c-2-3p	PAR-CLIP	20371350
MIRT490085	hsa-miR-6788-5p	PAR-CLIP	20371350
MIRT490084	hsa-miR-1908-5p	PAR-CLIP	20371350
MIRT490104	hsa-miR-6798-5p	PAR-CLIP	20371350
MIRT569948	hsa-miR-92b-5p	PAR-CLIP	20371350
MIRT490091	hsa-miR-3191-3p	PAR-CLIP	20371350
MIRT490089	hsa-miR-6795-5p	PAR-CLIP	20371350
MIRT490088	hsa-miR-6887-5p	PAR-CLIP	20371350
MIRT490084	hsa-miR-1908-5p	PAR-CLIP	20371350
MIRT490140	hsa-miR-4802-5p	PAR-CLIP	23592263
MIRT490141	hsa-miR-3126-5p	PAR-CLIP	23592263
MIRT490139	hsa-miR-6875-5p	PAR-CLIP	23592263
MIRT490138	hsa-miR-4534	PAR-CLIP	23592263
MIRT490137	hsa-miR-8082	PAR-CLIP	23592263
MIRT490136	hsa-miR-1249-5p	PAR-CLIP	23592263
MIRT490135	hsa-miR-6797-5p	PAR-CLIP	23592263
MIRT490134	hsa-miR-6515-5p	PAR-CLIP	23592263
MIRT490133	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT490132	hsa-miR-542-5p	PAR-CLIP	23592263
MIRT490117	hsa-miR-1273f	PAR-CLIP	23592263
MIRT490131	hsa-miR-509-3p	PAR-CLIP	23592263
MIRT490130	hsa-miR-4450	PAR-CLIP	23592263
MIRT490129	hsa-miR-4723-5p	PAR-CLIP	23592263
MIRT490128	hsa-miR-5698	PAR-CLIP	23592263
MIRT490111	hsa-miR-6870-5p	PAR-CLIP	23592263
MIRT490126	hsa-miR-7111-5p	PAR-CLIP	23592263
MIRT490127	hsa-miR-4525	PAR-CLIP	23592263
MIRT490125	hsa-miR-5010-5p	PAR-CLIP	23592263
MIRT490124	hsa-miR-328-5p	PAR-CLIP	23592263
MIRT490123	hsa-miR-6885-5p	PAR-CLIP	23592263
MIRT490122	hsa-miR-7704	PAR-CLIP	23592263
MIRT490121	hsa-miR-1275	PAR-CLIP	23592263
MIRT490120	hsa-miR-4665-5p	PAR-CLIP	23592263
MIRT490119	hsa-miR-7109-5p	PAR-CLIP	23592263
MIRT490118	hsa-miR-8089	PAR-CLIP	23592263
MIRT490117	hsa-miR-1273f	PAR-CLIP	23592263
MIRT490116	hsa-miR-1909-3p	PAR-CLIP	23592263
MIRT490115	hsa-miR-6722-3p	PAR-CLIP	23592263
MIRT490114	hsa-miR-184	PAR-CLIP	23592263
MIRT490113	hsa-miR-1207-5p	PAR-CLIP	23592263
MIRT490112	hsa-miR-4763-3p	PAR-CLIP	23592263
MIRT490111	hsa-miR-6870-5p	PAR-CLIP	23592263
MIRT490110	hsa-miR-483-5p	PAR-CLIP	23592263
MIRT490109	hsa-miR-7845-5p	PAR-CLIP	23592263
MIRT490108	hsa-miR-4716-3p	PAR-CLIP	23592263
MIRT490107	hsa-miR-6794-5p	PAR-CLIP	23592263
MIRT490106	hsa-miR-6871-5p	PAR-CLIP	23592263
MIRT490105	hsa-miR-211-3p	PAR-CLIP	23592263
MIRT490104	hsa-miR-6798-5p	PAR-CLIP	23592263
MIRT490103	hsa-miR-4787-5p	PAR-CLIP	23592263
MIRT490102	hsa-miR-3179	PAR-CLIP	23592263
MIRT490101	hsa-miR-3202	PAR-CLIP	23592263
MIRT490100	hsa-miR-6717-5p	PAR-CLIP	23592263
MIRT490099	hsa-miR-4747-5p	PAR-CLIP	23592263
MIRT490098	hsa-miR-5196-5p	PAR-CLIP	23592263
MIRT490097	hsa-miR-6878-5p	PAR-CLIP	23592263
MIRT490096	hsa-miR-6731-5p	PAR-CLIP	23592263
MIRT490095	hsa-miR-8085	PAR-CLIP	23592263
MIRT490094	hsa-miR-4271	PAR-CLIP	23592263
MIRT490093	hsa-miR-4725-3p	PAR-CLIP	23592263
MIRT490092	hsa-miR-6780b-5p	PAR-CLIP	23592263
MIRT490091	hsa-miR-3191-3p	PAR-CLIP	23592263
MIRT490090	hsa-miR-625-5p	PAR-CLIP	23592263
MIRT490089	hsa-miR-6795-5p	PAR-CLIP	23592263
MIRT490088	hsa-miR-6887-5p	PAR-CLIP	23592263
MIRT490087	hsa-miR-30c-1-3p	PAR-CLIP	23592263
MIRT490086	hsa-miR-30c-2-3p	PAR-CLIP	23592263
MIRT490085	hsa-miR-6788-5p	PAR-CLIP	23592263
MIRT490084	hsa-miR-1908-5p	PAR-CLIP	23592263
MIRT569953	hsa-miR-139-3p	PAR-CLIP	26701625
MIRT569953	hsa-miR-139-3p	PAR-CLIP	26701625
MIRT490094	hsa-miR-4271	PAR-CLIP	26701625
MIRT490094	hsa-miR-4271	PAR-CLIP	26701625
MIRT490093	hsa-miR-4725-3p	PAR-CLIP	26701625
MIRT490093	hsa-miR-4725-3p	PAR-CLIP	26701625
MIRT490092	hsa-miR-6780b-5p	PAR-CLIP	26701625
MIRT490092	hsa-miR-6780b-5p	PAR-CLIP	26701625
MIRT490118	hsa-miR-8089	PAR-CLIP	26701625
MIRT490118	hsa-miR-8089	PAR-CLIP	26701625
MIRT490110	hsa-miR-483-5p	PAR-CLIP	20371350
MIRT490140	hsa-miR-4802-5p	PAR-CLIP	20371350
MIRT490106	hsa-miR-6871-5p	PAR-CLIP	20371350
MIRT490132	hsa-miR-542-5p	PAR-CLIP	20371350
MIRT490138	hsa-miR-4534	PAR-CLIP	20371350
MIRT490137	hsa-miR-8082	PAR-CLIP	20371350
MIRT569953	hsa-miR-139-3p	PAR-CLIP	20371350
MIRT569952	hsa-miR-766-5p	PAR-CLIP	20371350
MIRT569951	hsa-miR-7154-3p	PAR-CLIP	20371350
MIRT569950	hsa-miR-765	PAR-CLIP	20371350
MIRT569949	hsa-miR-6894-5p	PAR-CLIP	20371350
MIRT490100	hsa-miR-6717-5p	PAR-CLIP	20371350
MIRT490097	hsa-miR-6878-5p	PAR-CLIP	20371350
MIRT490096	hsa-miR-6731-5p	PAR-CLIP	20371350
MIRT490095	hsa-miR-8085	PAR-CLIP	20371350
MIRT490087	hsa-miR-30c-1-3p	PAR-CLIP	20371350
MIRT490086	hsa-miR-30c-2-3p	PAR-CLIP	20371350
MIRT490085	hsa-miR-6788-5p	PAR-CLIP	20371350
MIRT490084	hsa-miR-1908-5p	PAR-CLIP	20371350
MIRT490104	hsa-miR-6798-5p	PAR-CLIP	20371350
MIRT569948	hsa-miR-92b-5p	PAR-CLIP	20371350
MIRT490091	hsa-miR-3191-3p	PAR-CLIP	20371350
MIRT490089	hsa-miR-6795-5p	PAR-CLIP	20371350
MIRT490088	hsa-miR-6887-5p	PAR-CLIP	20371350
MIRT490084	hsa-miR-1908-5p	PAR-CLIP	20371350
MIRT490140	hsa-miR-4802-5p	PAR-CLIP	23592263
MIRT490141	hsa-miR-3126-5p	PAR-CLIP	23592263
MIRT490139	hsa-miR-6875-5p	PAR-CLIP	23592263
MIRT490138	hsa-miR-4534	PAR-CLIP	23592263
MIRT490137	hsa-miR-8082	PAR-CLIP	23592263
MIRT490136	hsa-miR-1249-5p	PAR-CLIP	23592263
MIRT490135	hsa-miR-6797-5p	PAR-CLIP	23592263
MIRT490134	hsa-miR-6515-5p	PAR-CLIP	23592263
MIRT490133	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT490132	hsa-miR-542-5p	PAR-CLIP	23592263
MIRT490117	hsa-miR-1273f	PAR-CLIP	23592263
MIRT490131	hsa-miR-509-3p	PAR-CLIP	23592263
MIRT490130	hsa-miR-4450	PAR-CLIP	23592263
MIRT490129	hsa-miR-4723-5p	PAR-CLIP	23592263
MIRT490128	hsa-miR-5698	PAR-CLIP	23592263
MIRT490111	hsa-miR-6870-5p	PAR-CLIP	23592263
MIRT490126	hsa-miR-7111-5p	PAR-CLIP	23592263
MIRT490127	hsa-miR-4525	PAR-CLIP	23592263
MIRT490125	hsa-miR-5010-5p	PAR-CLIP	23592263
MIRT490124	hsa-miR-328-5p	PAR-CLIP	23592263
MIRT490123	hsa-miR-6885-5p	PAR-CLIP	23592263
MIRT490122	hsa-miR-7704	PAR-CLIP	23592263
MIRT490121	hsa-miR-1275	PAR-CLIP	23592263
MIRT490120	hsa-miR-4665-5p	PAR-CLIP	23592263
MIRT490119	hsa-miR-7109-5p	PAR-CLIP	23592263
MIRT490118	hsa-miR-8089	PAR-CLIP	23592263
MIRT490117	hsa-miR-1273f	PAR-CLIP	23592263
MIRT490116	hsa-miR-1909-3p	PAR-CLIP	23592263
MIRT490115	hsa-miR-6722-3p	PAR-CLIP	23592263
MIRT490114	hsa-miR-184	PAR-CLIP	23592263
MIRT490113	hsa-miR-1207-5p	PAR-CLIP	23592263
MIRT490112	hsa-miR-4763-3p	PAR-CLIP	23592263
MIRT490111	hsa-miR-6870-5p	PAR-CLIP	23592263
MIRT490110	hsa-miR-483-5p	PAR-CLIP	23592263
MIRT490109	hsa-miR-7845-5p	PAR-CLIP	23592263
MIRT490108	hsa-miR-4716-3p	PAR-CLIP	23592263
MIRT490107	hsa-miR-6794-5p	PAR-CLIP	23592263
MIRT490106	hsa-miR-6871-5p	PAR-CLIP	23592263
MIRT490105	hsa-miR-211-3p	PAR-CLIP	23592263
MIRT490104	hsa-miR-6798-5p	PAR-CLIP	23592263
MIRT490103	hsa-miR-4787-5p	PAR-CLIP	23592263
MIRT490102	hsa-miR-3179	PAR-CLIP	23592263
MIRT490101	hsa-miR-3202	PAR-CLIP	23592263
MIRT490100	hsa-miR-6717-5p	PAR-CLIP	23592263
MIRT490099	hsa-miR-4747-5p	PAR-CLIP	23592263
MIRT490098	hsa-miR-5196-5p	PAR-CLIP	23592263
MIRT490097	hsa-miR-6878-5p	PAR-CLIP	23592263
MIRT490096	hsa-miR-6731-5p	PAR-CLIP	23592263
MIRT490095	hsa-miR-8085	PAR-CLIP	23592263
MIRT490094	hsa-miR-4271	PAR-CLIP	23592263
MIRT490093	hsa-miR-4725-3p	PAR-CLIP	23592263
MIRT490092	hsa-miR-6780b-5p	PAR-CLIP	23592263
MIRT490091	hsa-miR-3191-3p	PAR-CLIP	23592263
MIRT490090	hsa-miR-625-5p	PAR-CLIP	23592263
MIRT490089	hsa-miR-6795-5p	PAR-CLIP	23592263
MIRT490088	hsa-miR-6887-5p	PAR-CLIP	23592263
MIRT490087	hsa-miR-30c-1-3p	PAR-CLIP	23592263
MIRT490086	hsa-miR-30c-2-3p	PAR-CLIP	23592263
MIRT490085	hsa-miR-6788-5p	PAR-CLIP	23592263
MIRT490084	hsa-miR-1908-5p	PAR-CLIP	23592263
MIRT1996346	hsa-miR-1292	CLIP-seq
MIRT1996347	hsa-miR-2392	CLIP-seq
MIRT1996348	hsa-miR-3144-5p	CLIP-seq
MIRT1996349	hsa-miR-3191	CLIP-seq
MIRT1996350	hsa-miR-3605-5p	CLIP-seq
MIRT1996351	hsa-miR-4652-5p	CLIP-seq
MIRT1996352	hsa-miR-625	CLIP-seq
MIRT2230328	hsa-miR-1909	CLIP-seq
MIRT1996347	hsa-miR-2392	CLIP-seq
MIRT1996349	hsa-miR-3191	CLIP-seq
MIRT1996350	hsa-miR-3605-5p	CLIP-seq
MIRT2230329	hsa-miR-486-3p	CLIP-seq
MIRT1996347	hsa-miR-2392	CLIP-seq
MIRT1996348	hsa-miR-3144-5p	CLIP-seq
MIRT1996349	hsa-miR-3191	CLIP-seq
MIRT1996350	hsa-miR-3605-5p	CLIP-seq
MIRT1996351	hsa-miR-4652-5p	CLIP-seq
MIRT1996352	hsa-miR-625	CLIP-seq

Show/Hide all (20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0005524	Function	ATP binding	IEA
GO:0005739	Component	Mitochondrion	IDA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0016301	Function	Kinase activity	IBA
GO:0016301	Function	Kinase activity	IEA
GO:0016301	Function	Kinase activity	TAS
GO:0016740	Function	Transferase activity	IEA
GO:0030389	Process	Fructosamine metabolic process	IBA
GO:0030389	Process	Fructosamine metabolic process	IEA
GO:0030393	Process	Fructoselysine metabolic process	NAS	11016445
GO:0030855	Process	Epithelial cell differentiation	IEP	21492153
GO:0036525	Process	Protein deglycation	IDA	11522682, 11975663
GO:0043687	Process	Post-translational protein modification	TAS
GO:0102193	Function	Protein-ribulosamine 3-kinase activity	IEA
GO:0102194	Function	Protein-fructosamine 3-kinase activity	IDA	11016445, 11522682, 11975663
GO:0102194	Function	Protein-fructosamine 3-kinase activity	IEA
GO:0102194	Function	Protein-fructosamine 3-kinase activity	NAS	11016445

MIM	HGNC	e!Ensembl
608425	24822	ENSG00000167363

Q9H479

Protein name

Fructosamine-3-kinase (EC 2.7.1.171) (Protein-psicosamine 3-kinase FN3K) (Protein-ribulosamine 3-kinase FN3K) (EC 2.7.1.172)

Protein function

Fructosamine-3-kinase involved in protein deglycation by mediating phosphorylation of fructoselysine residues on glycated proteins, to generate fructoselysine-3 phosphate (PubMed:11016445, PubMed:11522682, PubMed:11975663). Fructoselysine-3 phos

PDB

8UE1 , 9CX8 , 9CXM , 9CXN , 9CXO , 9CXV , 9CXW

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03881	Fructosamin_kin	2 → 309	Fructosamine kinase	Family

Tissue specificity

TISSUE SPECIFICITY: Widely expressed (PubMed:11522682). Expressed in erythrocytes (PubMed:11016445). {ECO:0000269|PubMed:11016445, ECO:0000269|PubMed:11522682}.

Sequence

MEQLLRAELRTATLRAFGGPGAGCISEGRAYDTDAGPVFVKVNRRTQARQMFEGEVASLE
ALRSTGLVRVPRPMKVIDLPGGGAAFVMEHLKMKSLSSQASKLGEQMADLHLYNQKLREK
LKEEENTVGRRGEGAEPQYVDKFGFHTVTCCGFIPQVNEWQDDWPTFFARHRLQAQLDLI
EKDYADREARELWSRLQVKIPDLFCGLEIVPALLHGDLWSGNVAEDDVGPIIYDPASFYG
HSEFELAIALMFGGFPRSFFTAYHRKIPKAPGFDQRLLLYQLFNYLNHWNHFGREYRSPS
LGTMRRLLK

Sequence length

309

Interactions

View interactions

	Reactome
			Gamma carboxylation, hypusine formation and arylsulfatase activation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (17)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Anemia Hemolytic	Hemolytic anemia	Pubtator	32467223	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	37910519	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	31420355		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	18334852		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	23492569, 24908234, 26352355		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	21288167, 23492569, 24908234, 26352355		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus	Diabetes mellitus	Pubtator	24908234, 26352355	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	19834870		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	23492569		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	16523184		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	32467223	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	21319141	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	31420355		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	18334852, 31398338		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	18334852		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	21319141	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	24908234, 32467223	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

FN3K (fructosamine 3 kinase)