Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	64110
Gene name	MAGE family member F1
Gene symbol	MAGEF1
Synonyms (NCBI Gene)	MAGE-F1
Chromosome	3
Chromosome location	3q27.1
Summary	This intronless gene encodes a member of the MAGE superfamily. It is ubiquitously expressed in normal tissues and in tumor cells. This gene includes a microsatellite repeat in the coding region. [provided by RefSeq, Jul 2008]

182

Show/Hide all (182)

miRTarBase ID	miRNA	Experiments	Reference
MIRT044057	hsa-miR-361-5p	CLASH	23622248
MIRT040473	hsa-miR-615-3p	CLASH	23622248
MIRT663925	hsa-miR-548aa	HITS-CLIP	23824327
MIRT663924	hsa-miR-548ap-3p	HITS-CLIP	23824327
MIRT663923	hsa-miR-548t-3p	HITS-CLIP	23824327
MIRT663922	hsa-miR-148a-5p	HITS-CLIP	23824327
MIRT663921	hsa-miR-634	HITS-CLIP	23824327
MIRT663920	hsa-miR-548p	HITS-CLIP	23824327
MIRT663919	hsa-miR-5584-3p	HITS-CLIP	23824327
MIRT663918	hsa-miR-1323	HITS-CLIP	23824327
MIRT663917	hsa-miR-548o-3p	HITS-CLIP	23824327
MIRT663916	hsa-miR-545-3p	HITS-CLIP	23824327
MIRT663915	hsa-miR-22-5p	HITS-CLIP	23824327
MIRT663914	hsa-miR-520d-5p	HITS-CLIP	23824327
MIRT663913	hsa-miR-524-5p	HITS-CLIP	23824327
MIRT663925	hsa-miR-548aa	HITS-CLIP	23824327
MIRT663924	hsa-miR-548ap-3p	HITS-CLIP	23824327
MIRT663923	hsa-miR-548t-3p	HITS-CLIP	23824327
MIRT663922	hsa-miR-148a-5p	HITS-CLIP	23824327
MIRT663921	hsa-miR-634	HITS-CLIP	23824327
MIRT663920	hsa-miR-548p	HITS-CLIP	23824327
MIRT663919	hsa-miR-5584-3p	HITS-CLIP	23824327
MIRT663918	hsa-miR-1323	HITS-CLIP	23824327
MIRT663917	hsa-miR-548o-3p	HITS-CLIP	23824327
MIRT663916	hsa-miR-545-3p	HITS-CLIP	23824327
MIRT663915	hsa-miR-22-5p	HITS-CLIP	23824327
MIRT663914	hsa-miR-520d-5p	HITS-CLIP	23824327
MIRT663913	hsa-miR-524-5p	HITS-CLIP	23824327
MIRT1125755	hsa-miR-1227	CLIP-seq
MIRT1125756	hsa-miR-1244	CLIP-seq
MIRT1125757	hsa-miR-1275	CLIP-seq
MIRT1125758	hsa-miR-128	CLIP-seq
MIRT1125759	hsa-miR-1283	CLIP-seq
MIRT1125760	hsa-miR-139-5p	CLIP-seq
MIRT1125761	hsa-miR-144	CLIP-seq
MIRT1125762	hsa-miR-153	CLIP-seq
MIRT1125763	hsa-miR-193a-3p	CLIP-seq
MIRT1125764	hsa-miR-193b	CLIP-seq
MIRT1125765	hsa-miR-197	CLIP-seq
MIRT1125766	hsa-miR-199a-3p	CLIP-seq
MIRT1125767	hsa-miR-199b-3p	CLIP-seq
MIRT1125768	hsa-miR-205	CLIP-seq
MIRT1125769	hsa-miR-216a	CLIP-seq
MIRT1125770	hsa-miR-224	CLIP-seq
MIRT1125771	hsa-miR-27a	CLIP-seq
MIRT1125772	hsa-miR-27b	CLIP-seq
MIRT1125773	hsa-miR-3129-5p	CLIP-seq
MIRT1125774	hsa-miR-3144-5p	CLIP-seq
MIRT1125775	hsa-miR-3147	CLIP-seq
MIRT1125776	hsa-miR-3148	CLIP-seq
MIRT1125777	hsa-miR-3163	CLIP-seq
MIRT1125778	hsa-miR-331-3p	CLIP-seq
MIRT1125779	hsa-miR-338-5p	CLIP-seq
MIRT1125780	hsa-miR-3664-3p	CLIP-seq
MIRT1125781	hsa-miR-3679-3p	CLIP-seq
MIRT1125782	hsa-miR-3926	CLIP-seq
MIRT1125783	hsa-miR-3973	CLIP-seq
MIRT1125784	hsa-miR-409-3p	CLIP-seq
MIRT1125785	hsa-miR-411	CLIP-seq
MIRT1125786	hsa-miR-4305	CLIP-seq
MIRT1125787	hsa-miR-4308	CLIP-seq
MIRT1125788	hsa-miR-4310	CLIP-seq
MIRT1125789	hsa-miR-4317	CLIP-seq
MIRT1125790	hsa-miR-4425	CLIP-seq
MIRT1125791	hsa-miR-4436a	CLIP-seq
MIRT1125792	hsa-miR-4446-5p	CLIP-seq
MIRT1125793	hsa-miR-4477a	CLIP-seq
MIRT1125794	hsa-miR-448	CLIP-seq
MIRT1125795	hsa-miR-4489	CLIP-seq
MIRT1125796	hsa-miR-4645-3p	CLIP-seq
MIRT1125797	hsa-miR-4659a-3p	CLIP-seq
MIRT1125798	hsa-miR-4659b-3p	CLIP-seq
MIRT1125799	hsa-miR-4662a-3p	CLIP-seq
MIRT1125800	hsa-miR-4663	CLIP-seq
MIRT1125801	hsa-miR-4665-5p	CLIP-seq
MIRT1125802	hsa-miR-4668-3p	CLIP-seq
MIRT1125803	hsa-miR-4682	CLIP-seq
MIRT1125804	hsa-miR-4684-3p	CLIP-seq
MIRT1125805	hsa-miR-4698	CLIP-seq
MIRT1125806	hsa-miR-4700-3p	CLIP-seq
MIRT1125807	hsa-miR-4729	CLIP-seq
MIRT1125808	hsa-miR-4731-3p	CLIP-seq
MIRT1125809	hsa-miR-4755-3p	CLIP-seq
MIRT1125810	hsa-miR-4775	CLIP-seq
MIRT1125811	hsa-miR-4778-3p	CLIP-seq
MIRT1125812	hsa-miR-4789-5p	CLIP-seq
MIRT1125813	hsa-miR-4799-5p	CLIP-seq
MIRT1125814	hsa-miR-4801	CLIP-seq
MIRT1125815	hsa-miR-4803	CLIP-seq
MIRT1125816	hsa-miR-487a	CLIP-seq
MIRT1125817	hsa-miR-500a	CLIP-seq
MIRT1125818	hsa-miR-5096	CLIP-seq
MIRT1125819	hsa-miR-510	CLIP-seq
MIRT1125820	hsa-miR-520g	CLIP-seq
MIRT1125821	hsa-miR-520h	CLIP-seq
MIRT1125822	hsa-miR-545	CLIP-seq
MIRT1125823	hsa-miR-548n	CLIP-seq
MIRT1125824	hsa-miR-548o	CLIP-seq
MIRT1125825	hsa-miR-548s	CLIP-seq
MIRT1125826	hsa-miR-548t	CLIP-seq
MIRT1125827	hsa-miR-595	CLIP-seq
MIRT1125828	hsa-miR-605	CLIP-seq
MIRT1125829	hsa-miR-618	CLIP-seq
MIRT1125830	hsa-miR-648	CLIP-seq
MIRT1125831	hsa-miR-711	CLIP-seq
MIRT1125755	hsa-miR-1227	CLIP-seq
MIRT1125757	hsa-miR-1275	CLIP-seq
MIRT1125760	hsa-miR-139-5p	CLIP-seq
MIRT1125768	hsa-miR-205	CLIP-seq
MIRT1125769	hsa-miR-216a	CLIP-seq
MIRT1125770	hsa-miR-224	CLIP-seq
MIRT1125775	hsa-miR-3147	CLIP-seq
MIRT1125776	hsa-miR-3148	CLIP-seq
MIRT1125777	hsa-miR-3163	CLIP-seq
MIRT1125778	hsa-miR-331-3p	CLIP-seq
MIRT2035537	hsa-miR-33a	CLIP-seq
MIRT2035538	hsa-miR-33b	CLIP-seq
MIRT2035539	hsa-miR-3667-5p	CLIP-seq
MIRT1125781	hsa-miR-3679-3p	CLIP-seq
MIRT1125785	hsa-miR-411	CLIP-seq
MIRT1125786	hsa-miR-4305	CLIP-seq
MIRT1125787	hsa-miR-4308	CLIP-seq
MIRT1125788	hsa-miR-4310	CLIP-seq
MIRT1125789	hsa-miR-4317	CLIP-seq
MIRT1125790	hsa-miR-4425	CLIP-seq
MIRT1125792	hsa-miR-4446-5p	CLIP-seq
MIRT1125793	hsa-miR-4477a	CLIP-seq
MIRT1125795	hsa-miR-4489	CLIP-seq
MIRT1125800	hsa-miR-4663	CLIP-seq
MIRT1125801	hsa-miR-4665-5p	CLIP-seq
MIRT1125802	hsa-miR-4668-3p	CLIP-seq
MIRT1125803	hsa-miR-4682	CLIP-seq
MIRT1125807	hsa-miR-4729	CLIP-seq
MIRT1125809	hsa-miR-4755-3p	CLIP-seq
MIRT1125810	hsa-miR-4775	CLIP-seq
MIRT1125816	hsa-miR-487a	CLIP-seq
MIRT1125823	hsa-miR-548n	CLIP-seq
MIRT1125826	hsa-miR-548t	CLIP-seq
MIRT2035540	hsa-miR-590-3p	CLIP-seq
MIRT1125827	hsa-miR-595	CLIP-seq
MIRT1125830	hsa-miR-648	CLIP-seq
MIRT1125757	hsa-miR-1275	CLIP-seq
MIRT1125759	hsa-miR-1283	CLIP-seq
MIRT1125769	hsa-miR-216a	CLIP-seq
MIRT1125775	hsa-miR-3147	CLIP-seq
MIRT1125777	hsa-miR-3163	CLIP-seq
MIRT1125778	hsa-miR-331-3p	CLIP-seq
MIRT1125779	hsa-miR-338-5p	CLIP-seq
MIRT2266047	hsa-miR-3646	CLIP-seq
MIRT2035539	hsa-miR-3667-5p	CLIP-seq
MIRT2266048	hsa-miR-3671	CLIP-seq
MIRT1125781	hsa-miR-3679-3p	CLIP-seq
MIRT1125785	hsa-miR-411	CLIP-seq
MIRT1125786	hsa-miR-4305	CLIP-seq
MIRT1125787	hsa-miR-4308	CLIP-seq
MIRT1125788	hsa-miR-4310	CLIP-seq
MIRT1125790	hsa-miR-4425	CLIP-seq
MIRT1125792	hsa-miR-4446-5p	CLIP-seq
MIRT1125795	hsa-miR-4489	CLIP-seq
MIRT1125801	hsa-miR-4665-5p	CLIP-seq
MIRT1125802	hsa-miR-4668-3p	CLIP-seq
MIRT1125807	hsa-miR-4729	CLIP-seq
MIRT1125808	hsa-miR-4731-3p	CLIP-seq
MIRT2266049	hsa-miR-4758-3p	CLIP-seq
MIRT1125812	hsa-miR-4789-5p	CLIP-seq
MIRT1125814	hsa-miR-4801	CLIP-seq
MIRT1125816	hsa-miR-487a	CLIP-seq
MIRT1125822	hsa-miR-545	CLIP-seq
MIRT1125824	hsa-miR-548o	CLIP-seq
MIRT1125826	hsa-miR-548t	CLIP-seq
MIRT1125829	hsa-miR-618	CLIP-seq
MIRT2266050	hsa-miR-888	CLIP-seq
MIRT1125756	hsa-miR-1244	CLIP-seq
MIRT1125766	hsa-miR-199a-3p	CLIP-seq
MIRT1125767	hsa-miR-199b-3p	CLIP-seq
MIRT1125773	hsa-miR-3129-5p	CLIP-seq
MIRT1125774	hsa-miR-3144-5p	CLIP-seq
MIRT1125780	hsa-miR-3664-3p	CLIP-seq
MIRT1125791	hsa-miR-4436a	CLIP-seq
MIRT1125796	hsa-miR-4645-3p	CLIP-seq
MIRT1125819	hsa-miR-510	CLIP-seq
MIRT1125831	hsa-miR-711	CLIP-seq

Show/Hide all (8)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IBA
GO:0005515	Function	Protein binding	IPI	20864041, 25416956, 31515488, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IDA	29225034
GO:0016567	Process	Protein ubiquitination	IDA	29225034
GO:0060255	Process	Regulation of macromolecule metabolic process	IEA
GO:0080090	Process	Regulation of primary metabolic process	IEA
GO:2000042	Process	Negative regulation of double-strand break repair via homologous recombination	IDA	29225034

MIM	HGNC	e!Ensembl
609267	29639	ENSG00000177383

Q9HAY2

Protein name

Melanoma-associated antigen F1 (MAGE-F1) (MAGE-F1 antigen)

Protein function

Enhances ubiquitin ligase activity of RING-type zinc finger-containing E3 ubiquitin ligases. Proposed to act through recruitment and/or stabilization of the E2 ubiquitin-conjugating enzyme at the E3:substrate complex. MAGEF1-NSMCE1 ubiquitin lig

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01454	MAGE	83 → 252	MAGE family	Family

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:11313144}.

Sequence

MLQTPESRGLPVPQAEGEKDGGHDGETRAPTASQERPKEELGAGREEGAAEPALTRKGAR
ALAAKALARRRAYRRLNRTVAELVQFLLVKDKKKSPITRSEMVKYVIGDLKILFPDIIAR
AAEHLRYVFGFELKQFDRKHHTYILINKLKPLEEEEEEDLGGDGPRLGLLMMILGLIYMR
GNSAREAQVWEMLRRLGVQPSKYHFLFGYPKRLIMEDFVQQRYLSYRRVPHTNPPEYEFS
WGPRSNLEISKMEVLGFVAKLHKKEPQHWPVQYREALADEADRARAKARAEASMRARASA
RAGIHLW

Sequence length

307

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (6)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ANDROGENETIC ALOPECIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLOMERULONEPHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (6)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Breast Carcinoma	Breast Carcinoma	BEFREE	31516568		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	32941982	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	11313144		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	31516568		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	29225034		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11313144, 29225034		★★★★★ ★☆☆☆☆ Found in Text Mining only

MAGEF1 (MAGE family member F1)