Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	64108
Gene name	Receptor transporter protein 4
Gene symbol	RTP4
Synonyms (NCBI Gene)	IFRG28Z3CXXC4
Chromosome	3
Chromosome location	3q27.3

Show/Hide all (32)

miRTarBase ID	miRNA	Experiments	Reference
MIRT649950	hsa-miR-6835-3p	HITS-CLIP	23824327
MIRT649949	hsa-miR-330-3p	HITS-CLIP	23824327
MIRT649948	hsa-miR-4714-3p	HITS-CLIP	23824327
MIRT649947	hsa-miR-676-5p	HITS-CLIP	23824327
MIRT513420	hsa-miR-452-5p	PAR-CLIP	23446348
MIRT513419	hsa-miR-4676-3p	PAR-CLIP	23446348
MIRT513418	hsa-miR-892c-3p	PAR-CLIP	23446348
MIRT513417	hsa-miR-6847-5p	PAR-CLIP	23446348
MIRT513415	hsa-miR-4257	PAR-CLIP	23446348
MIRT513416	hsa-miR-1-5p	PAR-CLIP	23446348
MIRT513414	hsa-miR-485-3p	PAR-CLIP	23446348
MIRT513413	hsa-miR-539-3p	PAR-CLIP	23446348
MIRT513411	hsa-miR-3942-3p	PAR-CLIP	23446348
MIRT513412	hsa-miR-30a-3p	PAR-CLIP	23446348
MIRT513410	hsa-miR-30d-3p	PAR-CLIP	23446348
MIRT513409	hsa-miR-30e-3p	PAR-CLIP	23446348
MIRT649950	hsa-miR-6835-3p	HITS-CLIP	23824327
MIRT649949	hsa-miR-330-3p	HITS-CLIP	23824327
MIRT649948	hsa-miR-4714-3p	HITS-CLIP	23824327
MIRT649947	hsa-miR-676-5p	HITS-CLIP	23824327
MIRT513420	hsa-miR-452-5p	PAR-CLIP	23446348
MIRT513419	hsa-miR-4676-3p	PAR-CLIP	23446348
MIRT513418	hsa-miR-892c-3p	PAR-CLIP	23446348
MIRT513417	hsa-miR-6847-5p	PAR-CLIP	23446348
MIRT513415	hsa-miR-4257	PAR-CLIP	23446348
MIRT513416	hsa-miR-1-5p	PAR-CLIP	23446348
MIRT513414	hsa-miR-485-3p	PAR-CLIP	23446348
MIRT513413	hsa-miR-539-3p	PAR-CLIP	23446348
MIRT513411	hsa-miR-3942-3p	PAR-CLIP	23446348
MIRT513412	hsa-miR-30a-3p	PAR-CLIP	23446348
MIRT513410	hsa-miR-30d-3p	PAR-CLIP	23446348
MIRT513409	hsa-miR-30e-3p	PAR-CLIP	23446348

Show/Hide all (14)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001580	Process	Detection of chemical stimulus involved in sensory perception of bitter taste	IBA
GO:0001580	Process	Detection of chemical stimulus involved in sensory perception of bitter taste	IDA	16720576
GO:0005515	Function	Protein binding	IPI	16720576, 32296183, 32814053
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	16720576
GO:0005737	Component	Cytoplasm	IEA
GO:0006612	Process	Protein targeting to membrane	IBA
GO:0006612	Process	Protein targeting to membrane	IDA	16720576
GO:0008270	Function	Zinc ion binding	IEA
GO:0016020	Component	Membrane	IEA
GO:0031849	Function	Olfactory receptor binding	IBA
GO:0046872	Function	Metal ion binding	IEA
GO:0051205	Process	Protein insertion into membrane	IBA
GO:0051607	Process	Defense response to virus	IDA	21478870

MIM	HGNC	e!Ensembl
609350	23992	ENSG00000136514

Q96DX8

Protein name

Receptor-transporting protein 4 (28 kDa interferon-responsive protein) (3CxxC-type zinc finger protein 4)

Protein function

Chaperone protein that facilitates the trafficking and functional cell surface expression of some G-protein coupled receptors (GPCRs) (PubMed:18836069). Promotes functional expression of the bitter taste receptor TAS2R16 (PubMed:16720576). Also

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13695	zf-3CxxC	48 → 160	Zinc-binding domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in circumvallate papillae and testis. {ECO:0000269|PubMed:16720576}.

Sequence

MVVDFWTWEQTFQELIQEAKPRATWTLKLDGNLQLDCLAQGWKQYQQRAFGWFRCSSCQR
SWASAQVQILCHTYWEHWTSQGQVRMRLFGQRCQKCSWSQYEMPEFSSDSTMRILSNLVQ
HILKKYYGNGTRKSPEMPVILEVSLEGSHDTANCEACTLGICGQGLKSCMTKPSKSLLPH
LKTGNSSPGIGAVYLANQAKNQSAEAKEAKGSGYEKLGPSRDPDPLNICVFILLLVFIVV
KCFTSE

Sequence length

246

Interactions

View interactions

	Reactome
			Olfactory Signaling Pathway

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
OLIGODENDROGLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, HIP	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (9)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Breast Carcinoma	Breast Carcinoma	BEFREE	23592719		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	35655479	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	37071001	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	36405750	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	23592719		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	34154655	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	34384424	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	32788627	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sjogren's Syndrome	Sjogren syndrome	Pubtator	35075430	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

RTP4 (receptor transporter protein 4)