Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	64098
Gene name	Parvin gamma
Gene symbol	PARVG
Synonyms (NCBI Gene)	-
Chromosome	22
Chromosome location	22q13.31
Summary	Members of the parvin family, including PARVG, are actin-binding proteins associated with focal contacts.[supplied by OMIM, Aug 2004]

173

Show/Hide all (173)

miRTarBase ID	miRNA	Experiments	Reference
MIRT047888	hsa-miR-30c-5p	CLASH	23622248
MIRT040637	hsa-miR-92b-3p	CLASH	23622248
MIRT508548	hsa-miR-6805-5p	PAR-CLIP	20371350
MIRT508547	hsa-miR-4802-5p	PAR-CLIP	20371350
MIRT508546	hsa-miR-3622a-3p	PAR-CLIP	20371350
MIRT508545	hsa-miR-3622b-3p	PAR-CLIP	20371350
MIRT508544	hsa-miR-4468	PAR-CLIP	20371350
MIRT508543	hsa-miR-6804-3p	PAR-CLIP	20371350
MIRT508542	hsa-miR-3665	PAR-CLIP	20371350
MIRT508541	hsa-miR-1249-5p	PAR-CLIP	20371350
MIRT508540	hsa-miR-6797-5p	PAR-CLIP	20371350
MIRT508539	hsa-miR-6515-5p	PAR-CLIP	20371350
MIRT508548	hsa-miR-6805-5p	PAR-CLIP	20371350
MIRT508547	hsa-miR-4802-5p	PAR-CLIP	20371350
MIRT508546	hsa-miR-3622a-3p	PAR-CLIP	20371350
MIRT508545	hsa-miR-3622b-3p	PAR-CLIP	20371350
MIRT508544	hsa-miR-4468	PAR-CLIP	20371350
MIRT508543	hsa-miR-6804-3p	PAR-CLIP	20371350
MIRT508542	hsa-miR-3665	PAR-CLIP	20371350
MIRT508541	hsa-miR-1249-5p	PAR-CLIP	20371350
MIRT508540	hsa-miR-6797-5p	PAR-CLIP	20371350
MIRT508539	hsa-miR-6515-5p	PAR-CLIP	20371350
MIRT508548	hsa-miR-6805-5p	PAR-CLIP	20371350
MIRT508547	hsa-miR-4802-5p	PAR-CLIP	20371350
MIRT508546	hsa-miR-3622a-3p	PAR-CLIP	20371350
MIRT508545	hsa-miR-3622b-3p	PAR-CLIP	20371350
MIRT508544	hsa-miR-4468	PAR-CLIP	20371350
MIRT508543	hsa-miR-6804-3p	PAR-CLIP	20371350
MIRT508542	hsa-miR-3665	PAR-CLIP	20371350
MIRT508541	hsa-miR-1249-5p	PAR-CLIP	20371350
MIRT508540	hsa-miR-6797-5p	PAR-CLIP	20371350
MIRT508539	hsa-miR-6515-5p	PAR-CLIP	20371350
MIRT508548	hsa-miR-6805-5p	PAR-CLIP	23446348
MIRT508547	hsa-miR-4802-5p	PAR-CLIP	23446348
MIRT508546	hsa-miR-3622a-3p	PAR-CLIP	23446348
MIRT508545	hsa-miR-3622b-3p	PAR-CLIP	23446348
MIRT508544	hsa-miR-4468	PAR-CLIP	23446348
MIRT508543	hsa-miR-6804-3p	PAR-CLIP	23446348
MIRT508542	hsa-miR-3665	PAR-CLIP	23446348
MIRT508541	hsa-miR-1249-5p	PAR-CLIP	23446348
MIRT508540	hsa-miR-6797-5p	PAR-CLIP	23446348
MIRT508539	hsa-miR-6515-5p	PAR-CLIP	23446348
MIRT508548	hsa-miR-6805-5p	PAR-CLIP	23446348
MIRT508547	hsa-miR-4802-5p	PAR-CLIP	23446348
MIRT508546	hsa-miR-3622a-3p	PAR-CLIP	23446348
MIRT508545	hsa-miR-3622b-3p	PAR-CLIP	23446348
MIRT508544	hsa-miR-4468	PAR-CLIP	23446348
MIRT508543	hsa-miR-6804-3p	PAR-CLIP	23446348
MIRT508542	hsa-miR-3665	PAR-CLIP	23446348
MIRT508541	hsa-miR-1249-5p	PAR-CLIP	23446348
MIRT508540	hsa-miR-6797-5p	PAR-CLIP	23446348
MIRT508539	hsa-miR-6515-5p	PAR-CLIP	23446348
MIRT508548	hsa-miR-6805-5p	PAR-CLIP	20371350
MIRT508547	hsa-miR-4802-5p	PAR-CLIP	20371350
MIRT508546	hsa-miR-3622a-3p	PAR-CLIP	20371350
MIRT508545	hsa-miR-3622b-3p	PAR-CLIP	20371350
MIRT508544	hsa-miR-4468	PAR-CLIP	20371350
MIRT508543	hsa-miR-6804-3p	PAR-CLIP	20371350
MIRT508542	hsa-miR-3665	PAR-CLIP	20371350
MIRT508541	hsa-miR-1249-5p	PAR-CLIP	20371350
MIRT508540	hsa-miR-6797-5p	PAR-CLIP	20371350
MIRT508539	hsa-miR-6515-5p	PAR-CLIP	20371350
MIRT508548	hsa-miR-6805-5p	PAR-CLIP	20371350
MIRT508547	hsa-miR-4802-5p	PAR-CLIP	20371350
MIRT508546	hsa-miR-3622a-3p	PAR-CLIP	20371350
MIRT508545	hsa-miR-3622b-3p	PAR-CLIP	20371350
MIRT508544	hsa-miR-4468	PAR-CLIP	20371350
MIRT508543	hsa-miR-6804-3p	PAR-CLIP	20371350
MIRT508542	hsa-miR-3665	PAR-CLIP	20371350
MIRT508541	hsa-miR-1249-5p	PAR-CLIP	20371350
MIRT508540	hsa-miR-6797-5p	PAR-CLIP	20371350
MIRT508539	hsa-miR-6515-5p	PAR-CLIP	20371350
MIRT508548	hsa-miR-6805-5p	PAR-CLIP	20371350
MIRT508547	hsa-miR-4802-5p	PAR-CLIP	20371350
MIRT508546	hsa-miR-3622a-3p	PAR-CLIP	20371350
MIRT508545	hsa-miR-3622b-3p	PAR-CLIP	20371350
MIRT508544	hsa-miR-4468	PAR-CLIP	20371350
MIRT508543	hsa-miR-6804-3p	PAR-CLIP	20371350
MIRT508542	hsa-miR-3665	PAR-CLIP	20371350
MIRT508541	hsa-miR-1249-5p	PAR-CLIP	20371350
MIRT508540	hsa-miR-6797-5p	PAR-CLIP	20371350
MIRT508539	hsa-miR-6515-5p	PAR-CLIP	20371350
MIRT508548	hsa-miR-6805-5p	PAR-CLIP	23446348
MIRT508547	hsa-miR-4802-5p	PAR-CLIP	23446348
MIRT508546	hsa-miR-3622a-3p	PAR-CLIP	23446348
MIRT508545	hsa-miR-3622b-3p	PAR-CLIP	23446348
MIRT508544	hsa-miR-4468	PAR-CLIP	23446348
MIRT508543	hsa-miR-6804-3p	PAR-CLIP	23446348
MIRT508542	hsa-miR-3665	PAR-CLIP	23446348
MIRT508541	hsa-miR-1249-5p	PAR-CLIP	23446348
MIRT508540	hsa-miR-6797-5p	PAR-CLIP	23446348
MIRT508539	hsa-miR-6515-5p	PAR-CLIP	23446348
MIRT508548	hsa-miR-6805-5p	PAR-CLIP	23446348
MIRT508547	hsa-miR-4802-5p	PAR-CLIP	23446348
MIRT508546	hsa-miR-3622a-3p	PAR-CLIP	23446348
MIRT508545	hsa-miR-3622b-3p	PAR-CLIP	23446348
MIRT508544	hsa-miR-4468	PAR-CLIP	23446348
MIRT508543	hsa-miR-6804-3p	PAR-CLIP	23446348
MIRT508542	hsa-miR-3665	PAR-CLIP	23446348
MIRT508541	hsa-miR-1249-5p	PAR-CLIP	23446348
MIRT508540	hsa-miR-6797-5p	PAR-CLIP	23446348
MIRT508539	hsa-miR-6515-5p	PAR-CLIP	23446348
MIRT1214941	hsa-miR-1207-3p	CLIP-seq
MIRT1214942	hsa-miR-1587	CLIP-seq
MIRT1214943	hsa-miR-3155	CLIP-seq
MIRT1214944	hsa-miR-3155b	CLIP-seq
MIRT1214945	hsa-miR-326	CLIP-seq
MIRT1214946	hsa-miR-330-5p	CLIP-seq
MIRT1214947	hsa-miR-3660	CLIP-seq
MIRT1214948	hsa-miR-3689a-3p	CLIP-seq
MIRT1214949	hsa-miR-3689c	CLIP-seq
MIRT1214950	hsa-miR-378g	CLIP-seq
MIRT1214951	hsa-miR-4267	CLIP-seq
MIRT1214952	hsa-miR-4492	CLIP-seq
MIRT1214953	hsa-miR-4498	CLIP-seq
MIRT1214954	hsa-miR-4514	CLIP-seq
MIRT1214955	hsa-miR-4526	CLIP-seq
MIRT1214956	hsa-miR-4656	CLIP-seq
MIRT1214957	hsa-miR-4675	CLIP-seq
MIRT1214958	hsa-miR-4692	CLIP-seq
MIRT1214959	hsa-miR-4728-5p	CLIP-seq
MIRT1214960	hsa-miR-4741	CLIP-seq
MIRT1214961	hsa-miR-4768-3p	CLIP-seq
MIRT1214962	hsa-miR-484	CLIP-seq
MIRT1214963	hsa-miR-760	CLIP-seq
MIRT1214964	hsa-miR-762	CLIP-seq
MIRT1214965	hsa-miR-940	CLIP-seq
MIRT1214966	hsa-miR-1253	CLIP-seq
MIRT1214967	hsa-miR-4457	CLIP-seq
MIRT1214968	hsa-miR-4731-3p	CLIP-seq
MIRT1214969	hsa-miR-4740-3p	CLIP-seq
MIRT1214970	hsa-miR-4801	CLIP-seq
MIRT1214971	hsa-miR-640	CLIP-seq
MIRT1214942	hsa-miR-1587	CLIP-seq
MIRT1214972	hsa-miR-3148	CLIP-seq
MIRT1214973	hsa-miR-3652	CLIP-seq
MIRT1214950	hsa-miR-378g	CLIP-seq
MIRT1214974	hsa-miR-4430	CLIP-seq
MIRT1214975	hsa-miR-4487	CLIP-seq
MIRT1214952	hsa-miR-4492	CLIP-seq
MIRT1214953	hsa-miR-4498	CLIP-seq
MIRT1214956	hsa-miR-4656	CLIP-seq
MIRT1214957	hsa-miR-4675	CLIP-seq
MIRT1214960	hsa-miR-4741	CLIP-seq
MIRT1214976	hsa-miR-615-5p	CLIP-seq
MIRT1214964	hsa-miR-762	CLIP-seq
MIRT1214977	hsa-miR-875-3p	CLIP-seq
MIRT1922304	hsa-miR-4501	CLIP-seq
MIRT1922305	hsa-miR-4504	CLIP-seq
MIRT1922306	hsa-miR-542-3p	CLIP-seq
MIRT1922307	hsa-miR-603	CLIP-seq
MIRT1922308	hsa-miR-642b	CLIP-seq
MIRT1214942	hsa-miR-1587	CLIP-seq
MIRT2061883	hsa-miR-3150a-3p	CLIP-seq
MIRT2061884	hsa-miR-3151	CLIP-seq
MIRT2061885	hsa-miR-3175	CLIP-seq
MIRT1214973	hsa-miR-3652	CLIP-seq
MIRT1214950	hsa-miR-378g	CLIP-seq
MIRT2061886	hsa-miR-4300	CLIP-seq
MIRT1214974	hsa-miR-4430	CLIP-seq
MIRT2061887	hsa-miR-4447	CLIP-seq
MIRT2061888	hsa-miR-4472	CLIP-seq
MIRT1214975	hsa-miR-4487	CLIP-seq
MIRT1214952	hsa-miR-4492	CLIP-seq
MIRT1214953	hsa-miR-4498	CLIP-seq
MIRT1214956	hsa-miR-4656	CLIP-seq
MIRT1214957	hsa-miR-4675	CLIP-seq
MIRT1214960	hsa-miR-4741	CLIP-seq
MIRT2061889	hsa-miR-491-5p	CLIP-seq
MIRT1214964	hsa-miR-762	CLIP-seq
MIRT1214977	hsa-miR-875-3p	CLIP-seq
MIRT2061890	hsa-miR-920	CLIP-seq
MIRT2061891	hsa-miR-939	CLIP-seq

Show/Hide all (21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003779	Function	Actin binding	IBA
GO:0003779	Function	Actin binding	IEA
GO:0003779	Function	Actin binding	TAS	11171322
GO:0005515	Function	Protein binding	IPI	25416956, 27107012, 28514442, 31515488, 32296183, 32814053, 33961781, 36217029
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005856	Component	Cytoskeleton	TAS	11171322
GO:0005886	Component	Plasma membrane	IEA
GO:0005925	Component	Focal adhesion	IBA
GO:0005925	Component	Focal adhesion	IEA
GO:0007155	Process	Cell adhesion	IEA
GO:0007160	Process	Cell-matrix adhesion	TAS	11171322
GO:0015629	Component	Actin cytoskeleton	IBA
GO:0016020	Component	Membrane	IEA
GO:0030031	Process	Cell projection assembly	IBA
GO:0030036	Process	Actin cytoskeleton organization	IBA
GO:0030036	Process	Actin cytoskeleton organization	IEA
GO:0034446	Process	Substrate adhesion-dependent cell spreading	IBA
GO:0070161	Component	Anchoring junction	IEA
GO:0071963	Process	Establishment or maintenance of cell polarity regulating cell shape	IBA

MIM	HGNC	e!Ensembl
608122	14654	ENSG00000138964

Q9HBI0

Protein name

Gamma-parvin

Protein function

Plays a role with ILK in promoting the cell adhesion and spreading of leukocytes.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00307	CH	44 → 152	Calponin homology (CH) domain	Domain
PF00307	CH	210 → 318	Calponin homology (CH) domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed predominantly in lymphoid organs, including spleen, thymus, lymph node, bone marrow and peripheral blood leukocytes and moderately in the digestive tract, including stomach, duodenum, jejunum, ileum, ileocecum and appendix, a

Sequence

MEPEFLYDLLQLPKGVEPPAEEELSKGGKKKYLPPTSRKDPKFEELQKVLMEWINATLLP
EHIVVRSLEEDMFDGLILHHLFQRLAALKLEAEDIALTATSQKHKLTVVLEAVNRSLQLE
EWQAKWSVESIFNKDLLSTLHLLVALAKRFQPDLSLPTNVQVEVITIESTKSGLKSEKLV
EQLTEYSTDKDEPPKDVFDELFKLAPEKVNAVKEAIVNFVNQKLDRLGLSVQNLDTQFAD
GVILLLLIGQLEGFFLHLKEFYLTPNSPAEMLHNVTLALELLKDEGLLSCPVSPEDIVNK
DAKSTLRVLYGLFCKHTQKAHRDRTPHGAPN

Sequence length

331

Interactions

View interactions

	KEGG
	Focal adhesion

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
COLONIC NEOPLASM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (14)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adult Oligodendroglioma	Oligodendroglioma	BEFREE	15993274		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	12810262		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	28029655	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Oligodendroglioma	Oligodendroglioma	BEFREE	15993274		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	12810262		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	36360783	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	35655721, 36575819	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	12810262		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12810262, 15993274		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12810262, 15993274		★★★★★ ★☆☆☆☆ Found in Text Mining only
oligodendroglioma	Oligodendroglioma	BEFREE	15993274		★★★★★ ★☆☆☆☆ Found in Text Mining only
oligodendroglioma	Oligodendroglioma	LHGDN	15993274		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	34621500	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Well Differentiated Oligodendroglioma	Oligodendroglioma	BEFREE	15993274		★★★★★ ★☆☆☆☆ Found in Text Mining only

PARVG (parvin gamma)