Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	64084
Gene name	Calsyntenin 2
Gene symbol	CLSTN2
Synonyms (NCBI Gene)	ALC-GAMMACDHR13CS2CSTN2alcagamma
Chromosome	3
Chromosome location	3q23

104

Show/Hide all (104)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029777	hsa-miR-26b-5p	Microarray	19088304
MIRT668977	hsa-miR-145-5p	HITS-CLIP	23824327
MIRT668976	hsa-miR-5195-3p	HITS-CLIP	23824327
MIRT668975	hsa-miR-3607-3p	HITS-CLIP	23824327
MIRT668974	hsa-miR-3180-5p	HITS-CLIP	23824327
MIRT668977	hsa-miR-145-5p	HITS-CLIP	23824327
MIRT668976	hsa-miR-5195-3p	HITS-CLIP	23824327
MIRT668975	hsa-miR-3607-3p	HITS-CLIP	23824327
MIRT668974	hsa-miR-3180-5p	HITS-CLIP	23824327
MIRT897964	hsa-miR-1207-5p	CLIP-seq
MIRT897965	hsa-miR-1245b-5p	CLIP-seq
MIRT897966	hsa-miR-1301	CLIP-seq
MIRT897967	hsa-miR-22	CLIP-seq
MIRT897968	hsa-miR-299-3p	CLIP-seq
MIRT897969	hsa-miR-3123	CLIP-seq
MIRT897970	hsa-miR-3142	CLIP-seq
MIRT897971	hsa-miR-3611	CLIP-seq
MIRT897972	hsa-miR-3689d	CLIP-seq
MIRT897973	hsa-miR-4265	CLIP-seq
MIRT897974	hsa-miR-4296	CLIP-seq
MIRT897975	hsa-miR-4297	CLIP-seq
MIRT897976	hsa-miR-4322	CLIP-seq
MIRT897977	hsa-miR-4417	CLIP-seq
MIRT897978	hsa-miR-4493	CLIP-seq
MIRT897979	hsa-miR-4514	CLIP-seq
MIRT897980	hsa-miR-4531	CLIP-seq
MIRT897981	hsa-miR-4640-5p	CLIP-seq
MIRT897982	hsa-miR-4645-5p	CLIP-seq
MIRT897983	hsa-miR-4667-5p	CLIP-seq
MIRT897984	hsa-miR-4670-3p	CLIP-seq
MIRT897985	hsa-miR-4673	CLIP-seq
MIRT897986	hsa-miR-4692	CLIP-seq
MIRT897987	hsa-miR-4700-5p	CLIP-seq
MIRT897988	hsa-miR-4726-5p	CLIP-seq
MIRT897989	hsa-miR-4736	CLIP-seq
MIRT897990	hsa-miR-4755-3p	CLIP-seq
MIRT897991	hsa-miR-4763-3p	CLIP-seq
MIRT897992	hsa-miR-4765	CLIP-seq
MIRT897993	hsa-miR-5047	CLIP-seq
MIRT897994	hsa-miR-642b	CLIP-seq
MIRT897995	hsa-miR-661	CLIP-seq
MIRT897996	hsa-miR-922	CLIP-seq
MIRT897997	hsa-miR-939	CLIP-seq
MIRT897972	hsa-miR-3689d	CLIP-seq
MIRT897983	hsa-miR-4667-5p	CLIP-seq
MIRT897987	hsa-miR-4700-5p	CLIP-seq
MIRT897992	hsa-miR-4765	CLIP-seq
MIRT897994	hsa-miR-642b	CLIP-seq
MIRT897995	hsa-miR-661	CLIP-seq
MIRT1546523	hsa-miR-935	CLIP-seq
MIRT897997	hsa-miR-939	CLIP-seq
MIRT897972	hsa-miR-3689d	CLIP-seq
MIRT897983	hsa-miR-4667-5p	CLIP-seq
MIRT897987	hsa-miR-4700-5p	CLIP-seq
MIRT897992	hsa-miR-4765	CLIP-seq
MIRT897994	hsa-miR-642b	CLIP-seq
MIRT897995	hsa-miR-661	CLIP-seq
MIRT897997	hsa-miR-939	CLIP-seq
MIRT1966287	hsa-miR-103a	CLIP-seq
MIRT1966288	hsa-miR-107	CLIP-seq
MIRT1966289	hsa-miR-10a	CLIP-seq
MIRT1966290	hsa-miR-10b	CLIP-seq
MIRT897964	hsa-miR-1207-5p	CLIP-seq
MIRT897966	hsa-miR-1301	CLIP-seq
MIRT897967	hsa-miR-22	CLIP-seq
MIRT897972	hsa-miR-3689d	CLIP-seq
MIRT1966291	hsa-miR-4436a	CLIP-seq
MIRT1966292	hsa-miR-4471	CLIP-seq
MIRT897983	hsa-miR-4667-5p	CLIP-seq
MIRT1966293	hsa-miR-4700-3p	CLIP-seq
MIRT897987	hsa-miR-4700-5p	CLIP-seq
MIRT897989	hsa-miR-4736	CLIP-seq
MIRT897991	hsa-miR-4763-3p	CLIP-seq
MIRT897992	hsa-miR-4765	CLIP-seq
MIRT897993	hsa-miR-5047	CLIP-seq
MIRT1966294	hsa-miR-548v	CLIP-seq
MIRT897994	hsa-miR-642b	CLIP-seq
MIRT897995	hsa-miR-661	CLIP-seq
MIRT1546523	hsa-miR-935	CLIP-seq
MIRT897997	hsa-miR-939	CLIP-seq
MIRT2202135	hsa-miR-1294	CLIP-seq
MIRT897972	hsa-miR-3689d	CLIP-seq
MIRT2202136	hsa-miR-3929	CLIP-seq
MIRT2202137	hsa-miR-4419b	CLIP-seq
MIRT2202138	hsa-miR-4478	CLIP-seq
MIRT897983	hsa-miR-4667-5p	CLIP-seq
MIRT897987	hsa-miR-4700-5p	CLIP-seq
MIRT2202139	hsa-miR-4710	CLIP-seq
MIRT897992	hsa-miR-4765	CLIP-seq
MIRT897994	hsa-miR-642b	CLIP-seq
MIRT897995	hsa-miR-661	CLIP-seq
MIRT897997	hsa-miR-939	CLIP-seq
MIRT2386227	hsa-miR-3187-3p	CLIP-seq
MIRT897972	hsa-miR-3689d	CLIP-seq
MIRT2386228	hsa-miR-378g	CLIP-seq
MIRT2386229	hsa-miR-4420	CLIP-seq
MIRT2386230	hsa-miR-4529-5p	CLIP-seq
MIRT897983	hsa-miR-4667-5p	CLIP-seq
MIRT897987	hsa-miR-4700-5p	CLIP-seq
MIRT2386231	hsa-miR-4731-5p	CLIP-seq
MIRT897992	hsa-miR-4765	CLIP-seq
MIRT897994	hsa-miR-642b	CLIP-seq
MIRT897995	hsa-miR-661	CLIP-seq
MIRT897997	hsa-miR-939	CLIP-seq

Show/Hide all (25)

GO ID	Ontology	Definition	Evidence
GO:0000139	Component	Golgi membrane	IEA
GO:0005509	Function	Calcium ion binding	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0007155	Process	Cell adhesion	IEA
GO:0007156	Process	Homophilic cell adhesion via plasma membrane adhesion molecules	IEA
GO:0008306	Process	Associative learning	IEA
GO:0009986	Component	Cell surface	IBA
GO:0009986	Component	Cell surface	IEA
GO:0014069	Component	Postsynaptic density	IEA
GO:0016020	Component	Membrane	IEA
GO:0030425	Component	Dendrite	IEA
GO:0042995	Component	Cell projection	IEA
GO:0045202	Component	Synapse	IEA
GO:0045211	Component	Postsynaptic membrane	IBA
GO:0045211	Component	Postsynaptic membrane	IEA
GO:0050806	Process	Positive regulation of synaptic transmission	IBA
GO:0050806	Process	Positive regulation of synaptic transmission	IEA
GO:0051965	Process	Positive regulation of synapse assembly	IBA
GO:0051965	Process	Positive regulation of synapse assembly	IEA
GO:0098839	Component	Postsynaptic density membrane	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:1904862	Process	Inhibitory synapse assembly	IEA

MIM	HGNC	e!Ensembl
611323	17448	ENSG00000158258

Q9H4D0

Protein name

Calsyntenin-2 (Alcadein-gamma) (Alc-gamma)

Protein function

Postsynaptic adhesion molecule that binds to presynaptic neurexins to mediate synapse formation, and which is involved in learning and memory (By similarity). Promotes synapse development by acting as a cell adhesion molecule at the postsynaptic

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00028	Cadherin	165 → 254	Cadherin domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Restricted to the brain. {ECO:0000269|PubMed:12498782}.

Sequence

MLPGRLCWVPLLLALGVGSGSGGGGDSRQRRLLAAKVNKHKPWIETSYHGVITENNDTVI
LDPPLVALDKDAPVPFAGEICAFKIHGQELPFEAVVLNKTSGEGRLRAKSPIDCELQKEY
TFIIQAYDCGAGPHETAWKKSHKAVVHIQVKDVNEFAPTFKEPAYKAVVTEGKIYDSILQ
VEAIDEDCSPQYSQICNYEIVTTDVPFAIDRNGNIRNTEKLSYDKQHQYEILVTAYDCGQ
KPAAQDTLVQVDVKPVCKPGWQDWTKRIEYQPGSGSMPLFPSIHLETCDGAVSSLQIVTE
LQTNYIGKGCDRETYSEKSLQKLCGASSGIIDLLPSPSAATNWTAGLLVDSSEMIFKFDG
RQGAKVPDGIVPKNLTDQFTITMWMKHGPSPGVRAEKETILCNSDKTEMNRHHYALYVHN
CRLVFLLRKDFDQADTFRPAEFHWKLDQICDKEWHYYVINVEFPVVTLYMDGATYEPYLV
TNDWPIHPSHIAMQLTVGACWQGGEVTKPQFAQFFHGSLASLTIRPGKMESQKVISCLQA
CKEGLDINSLESLGQGIKYHFNPSQSILVMEGDDIGNINRALQKVSYINSRQFPTAGVRR
LKVSSKVQCFGEDVCISIPEVDAYVMVLQAIEPRITLRGTDHFWRPAAQFESARGVTLFP
DIKIVSTFAKTEAPGDVKTTDPKSEVLEEMLHNLDFCDILVIGGDLDPRQECLELNHSEL
HQRHLDATNSTAGYSIYGVGSMSRYEQVLHHIRYRNWRPASLEARRFRIKCSELNGRYTS
NEFNLEVSILHEDQVSDKEHVNHLIVQPPFLQSVHHPESRSSIQHSSVVPSIATVVIIIS
VCMLVFVVAMGVYRVRIAHQHFIQETEAAKESEMDWDDSALTITVNPMEKHEGPGHGEDE
TEGEEEEEAEEEMSSSSGSDDSEEEEEEEGMGRGRHGQNGARQAQLEWDDSTLPY

Sequence length

955

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (21)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTROCYTOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DUCHENNE MUSCULAR DYSTROPHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HODGKINS LYMPHOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RETINAL DETACHMENT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RETINOPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (18)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Alzheimer Disease	Alzheimer disease	Pubtator	33797837	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	28647593		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	29991755	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	25080189		★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	40667715	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	GWASDB_DG	24920014		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	GWASCAT_DG	24920014		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	GWASCAT_DG	27903959		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	CTD_human_DG	19233941		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant neoplasm of liver	Liver Cancer	CTD_human_DG	19233941		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	GWASDB_DG	23472185		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	GWASCAT_DG	23472185		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myopia, Degenerative	Myopia	GWASCAT_DG	23049088		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	29991755		★★★★★ ★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	25080189		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	GWASDB_DG	19503088		★★★★★ ★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	25080189		★★★★★ ★☆☆☆☆ Found in Text Mining only

CLSTN2 (calsyntenin 2)