Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	64077
Gene name	Phospholysine phosphohistidine inorganic pyrophosphate phosphatase
Gene symbol	LHPP
Synonyms (NCBI Gene)	HDHD2B
Chromosome	10
Chromosome location	10q26.13

198

Show/Hide all (198)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018083	hsa-miR-335-5p	Microarray	18185580
MIRT456243	hsa-miR-224-3p	PAR-CLIP	21572407
MIRT456242	hsa-miR-522-3p	PAR-CLIP	21572407
MIRT456241	hsa-miR-6808-5p	PAR-CLIP	21572407
MIRT456240	hsa-miR-6893-5p	PAR-CLIP	21572407
MIRT456239	hsa-miR-940	PAR-CLIP	21572407
MIRT504248	hsa-miR-3929	PAR-CLIP	21572407
MIRT504247	hsa-miR-4419b	PAR-CLIP	21572407
MIRT504246	hsa-miR-4478	PAR-CLIP	21572407
MIRT504245	hsa-miR-5584-5p	PAR-CLIP	21572407
MIRT456238	hsa-miR-1247-3p	PAR-CLIP	21572407
MIRT456237	hsa-miR-4649-3p	PAR-CLIP	21572407
MIRT456236	hsa-miR-1827	PAR-CLIP	21572407
MIRT504244	hsa-miR-485-5p	PAR-CLIP	21572407
MIRT504243	hsa-miR-6884-5p	PAR-CLIP	21572407
MIRT504242	hsa-miR-7160-5p	PAR-CLIP	21572407
MIRT456235	hsa-miR-5093	PAR-CLIP	21572407
MIRT456234	hsa-miR-1207-5p	PAR-CLIP	21572407
MIRT456233	hsa-miR-4763-3p	PAR-CLIP	21572407
MIRT456232	hsa-miR-3650	PAR-CLIP	21572407
MIRT504241	hsa-miR-665	PAR-CLIP	21572407
MIRT456243	hsa-miR-224-3p	PAR-CLIP	23446348
MIRT456242	hsa-miR-522-3p	PAR-CLIP	23446348
MIRT456241	hsa-miR-6808-5p	PAR-CLIP	23446348
MIRT456240	hsa-miR-6893-5p	PAR-CLIP	23446348
MIRT456239	hsa-miR-940	PAR-CLIP	23446348
MIRT504248	hsa-miR-3929	PAR-CLIP	23446348
MIRT504247	hsa-miR-4419b	PAR-CLIP	23446348
MIRT504246	hsa-miR-4478	PAR-CLIP	23446348
MIRT504245	hsa-miR-5584-5p	PAR-CLIP	23446348
MIRT456238	hsa-miR-1247-3p	PAR-CLIP	23446348
MIRT456237	hsa-miR-4649-3p	PAR-CLIP	23446348
MIRT456236	hsa-miR-1827	PAR-CLIP	23446348
MIRT504244	hsa-miR-485-5p	PAR-CLIP	23446348
MIRT504243	hsa-miR-6884-5p	PAR-CLIP	23446348
MIRT504242	hsa-miR-7160-5p	PAR-CLIP	23446348
MIRT456235	hsa-miR-5093	PAR-CLIP	23446348
MIRT456234	hsa-miR-1207-5p	PAR-CLIP	23446348
MIRT456233	hsa-miR-4763-3p	PAR-CLIP	23446348
MIRT456232	hsa-miR-3650	PAR-CLIP	23446348
MIRT504241	hsa-miR-665	PAR-CLIP	23446348
MIRT456243	hsa-miR-224-3p	PAR-CLIP	23592263
MIRT456242	hsa-miR-522-3p	PAR-CLIP	23592263
MIRT456241	hsa-miR-6808-5p	PAR-CLIP	23592263
MIRT456240	hsa-miR-6893-5p	PAR-CLIP	23592263
MIRT456239	hsa-miR-940	PAR-CLIP	23592263
MIRT456238	hsa-miR-1247-3p	PAR-CLIP	23592263
MIRT456237	hsa-miR-4649-3p	PAR-CLIP	23592263
MIRT456236	hsa-miR-1827	PAR-CLIP	23592263
MIRT456235	hsa-miR-5093	PAR-CLIP	23592263
MIRT456234	hsa-miR-1207-5p	PAR-CLIP	23592263
MIRT456233	hsa-miR-4763-3p	PAR-CLIP	23592263
MIRT456232	hsa-miR-3650	PAR-CLIP	23592263
MIRT456243	hsa-miR-224-3p	PAR-CLIP	21572407
MIRT456242	hsa-miR-522-3p	PAR-CLIP	21572407
MIRT456241	hsa-miR-6808-5p	PAR-CLIP	21572407
MIRT456240	hsa-miR-6893-5p	PAR-CLIP	21572407
MIRT456239	hsa-miR-940	PAR-CLIP	21572407
MIRT504248	hsa-miR-3929	PAR-CLIP	21572407
MIRT504247	hsa-miR-4419b	PAR-CLIP	21572407
MIRT504246	hsa-miR-4478	PAR-CLIP	21572407
MIRT504245	hsa-miR-5584-5p	PAR-CLIP	21572407
MIRT456238	hsa-miR-1247-3p	PAR-CLIP	21572407
MIRT456237	hsa-miR-4649-3p	PAR-CLIP	21572407
MIRT456236	hsa-miR-1827	PAR-CLIP	21572407
MIRT504244	hsa-miR-485-5p	PAR-CLIP	21572407
MIRT504243	hsa-miR-6884-5p	PAR-CLIP	21572407
MIRT504242	hsa-miR-7160-5p	PAR-CLIP	21572407
MIRT456235	hsa-miR-5093	PAR-CLIP	21572407
MIRT456234	hsa-miR-1207-5p	PAR-CLIP	21572407
MIRT456233	hsa-miR-4763-3p	PAR-CLIP	21572407
MIRT456232	hsa-miR-3650	PAR-CLIP	21572407
MIRT504241	hsa-miR-665	PAR-CLIP	21572407
MIRT456243	hsa-miR-224-3p	PAR-CLIP	23446348
MIRT456242	hsa-miR-522-3p	PAR-CLIP	23446348
MIRT456241	hsa-miR-6808-5p	PAR-CLIP	23446348
MIRT456240	hsa-miR-6893-5p	PAR-CLIP	23446348
MIRT456239	hsa-miR-940	PAR-CLIP	23446348
MIRT504248	hsa-miR-3929	PAR-CLIP	23446348
MIRT504247	hsa-miR-4419b	PAR-CLIP	23446348
MIRT504246	hsa-miR-4478	PAR-CLIP	23446348
MIRT504245	hsa-miR-5584-5p	PAR-CLIP	23446348
MIRT456238	hsa-miR-1247-3p	PAR-CLIP	23446348
MIRT456237	hsa-miR-4649-3p	PAR-CLIP	23446348
MIRT456236	hsa-miR-1827	PAR-CLIP	23446348
MIRT504244	hsa-miR-485-5p	PAR-CLIP	23446348
MIRT504243	hsa-miR-6884-5p	PAR-CLIP	23446348
MIRT504242	hsa-miR-7160-5p	PAR-CLIP	23446348
MIRT456235	hsa-miR-5093	PAR-CLIP	23446348
MIRT456234	hsa-miR-1207-5p	PAR-CLIP	23446348
MIRT456233	hsa-miR-4763-3p	PAR-CLIP	23446348
MIRT456232	hsa-miR-3650	PAR-CLIP	23446348
MIRT504241	hsa-miR-665	PAR-CLIP	23446348
MIRT456243	hsa-miR-224-3p	PAR-CLIP	23592263
MIRT456242	hsa-miR-522-3p	PAR-CLIP	23592263
MIRT456241	hsa-miR-6808-5p	PAR-CLIP	23592263
MIRT456240	hsa-miR-6893-5p	PAR-CLIP	23592263
MIRT456239	hsa-miR-940	PAR-CLIP	23592263
MIRT456238	hsa-miR-1247-3p	PAR-CLIP	23592263
MIRT456237	hsa-miR-4649-3p	PAR-CLIP	23592263
MIRT456236	hsa-miR-1827	PAR-CLIP	23592263
MIRT456235	hsa-miR-5093	PAR-CLIP	23592263
MIRT456234	hsa-miR-1207-5p	PAR-CLIP	23592263
MIRT456233	hsa-miR-4763-3p	PAR-CLIP	23592263
MIRT456232	hsa-miR-3650	PAR-CLIP	23592263
MIRT1108923	hsa-miR-1285	CLIP-seq
MIRT1108924	hsa-miR-1321	CLIP-seq
MIRT1108925	hsa-miR-1587	CLIP-seq
MIRT1108926	hsa-miR-1908	CLIP-seq
MIRT1108927	hsa-miR-1909	CLIP-seq
MIRT1108928	hsa-miR-3150b-3p	CLIP-seq
MIRT1108929	hsa-miR-3187-5p	CLIP-seq
MIRT1108930	hsa-miR-3612	CLIP-seq
MIRT1108931	hsa-miR-378g	CLIP-seq
MIRT1108932	hsa-miR-4283	CLIP-seq
MIRT1108933	hsa-miR-4314	CLIP-seq
MIRT1108934	hsa-miR-4486	CLIP-seq
MIRT1108935	hsa-miR-4492	CLIP-seq
MIRT1108936	hsa-miR-4498	CLIP-seq
MIRT1108937	hsa-miR-4508	CLIP-seq
MIRT1108938	hsa-miR-4651	CLIP-seq
MIRT1108939	hsa-miR-4656	CLIP-seq
MIRT1108940	hsa-miR-4675	CLIP-seq
MIRT1108941	hsa-miR-4695-5p	CLIP-seq
MIRT1108942	hsa-miR-4739	CLIP-seq
MIRT1108943	hsa-miR-4741	CLIP-seq
MIRT1108944	hsa-miR-4756-5p	CLIP-seq
MIRT1108945	hsa-miR-4784	CLIP-seq
MIRT1108946	hsa-miR-608	CLIP-seq
MIRT1108947	hsa-miR-612	CLIP-seq
MIRT1108948	hsa-miR-650	CLIP-seq
MIRT1108949	hsa-miR-659	CLIP-seq
MIRT1108950	hsa-miR-663	CLIP-seq
MIRT1108951	hsa-miR-744	CLIP-seq
MIRT1108952	hsa-miR-762	CLIP-seq
MIRT1108953	hsa-miR-765	CLIP-seq
MIRT1108927	hsa-miR-1909	CLIP-seq
MIRT1108928	hsa-miR-3150b-3p	CLIP-seq
MIRT1108938	hsa-miR-4651	CLIP-seq
MIRT1108941	hsa-miR-4695-5p	CLIP-seq
MIRT1108945	hsa-miR-4784	CLIP-seq
MIRT1108946	hsa-miR-608	CLIP-seq
MIRT1108953	hsa-miR-765	CLIP-seq
MIRT1108926	hsa-miR-1908	CLIP-seq
MIRT1108927	hsa-miR-1909	CLIP-seq
MIRT2030109	hsa-miR-1976	CLIP-seq
MIRT2030110	hsa-miR-3155	CLIP-seq
MIRT2030111	hsa-miR-3155b	CLIP-seq
MIRT2030112	hsa-miR-331-3p	CLIP-seq
MIRT2030113	hsa-miR-34a	CLIP-seq
MIRT2030114	hsa-miR-34c-5p	CLIP-seq
MIRT2030115	hsa-miR-412	CLIP-seq
MIRT2030116	hsa-miR-4266	CLIP-seq
MIRT1108932	hsa-miR-4283	CLIP-seq
MIRT2030117	hsa-miR-4292	CLIP-seq
MIRT2030118	hsa-miR-4420	CLIP-seq
MIRT2030119	hsa-miR-449a	CLIP-seq
MIRT2030120	hsa-miR-449b	CLIP-seq
MIRT1108937	hsa-miR-4508	CLIP-seq
MIRT2030121	hsa-miR-4645-5p	CLIP-seq
MIRT1108938	hsa-miR-4651	CLIP-seq
MIRT2030122	hsa-miR-4659a-3p	CLIP-seq
MIRT2030123	hsa-miR-4659b-3p	CLIP-seq
MIRT2030124	hsa-miR-4673	CLIP-seq
MIRT1108941	hsa-miR-4695-5p	CLIP-seq
MIRT2030125	hsa-miR-4779	CLIP-seq
MIRT2030126	hsa-miR-484	CLIP-seq
MIRT1108946	hsa-miR-608	CLIP-seq
MIRT2030127	hsa-miR-629	CLIP-seq
MIRT1108950	hsa-miR-663	CLIP-seq
MIRT1108951	hsa-miR-744	CLIP-seq
MIRT1108953	hsa-miR-765	CLIP-seq
MIRT1108926	hsa-miR-1908	CLIP-seq
MIRT1108927	hsa-miR-1909	CLIP-seq
MIRT2261019	hsa-miR-203	CLIP-seq
MIRT2030115	hsa-miR-412	CLIP-seq
MIRT1108932	hsa-miR-4283	CLIP-seq
MIRT2030118	hsa-miR-4420	CLIP-seq
MIRT1108937	hsa-miR-4508	CLIP-seq
MIRT1108938	hsa-miR-4651	CLIP-seq
MIRT1108941	hsa-miR-4695-5p	CLIP-seq
MIRT2261020	hsa-miR-518a-5p	CLIP-seq
MIRT2261021	hsa-miR-527	CLIP-seq
MIRT1108946	hsa-miR-608	CLIP-seq
MIRT1108950	hsa-miR-663	CLIP-seq
MIRT1108951	hsa-miR-744	CLIP-seq
MIRT1108953	hsa-miR-765	CLIP-seq
MIRT1108926	hsa-miR-1908	CLIP-seq
MIRT1108927	hsa-miR-1909	CLIP-seq
MIRT1108932	hsa-miR-4283	CLIP-seq
MIRT1108933	hsa-miR-4314	CLIP-seq
MIRT1108937	hsa-miR-4508	CLIP-seq
MIRT1108938	hsa-miR-4651	CLIP-seq
MIRT1108941	hsa-miR-4695-5p	CLIP-seq
MIRT1108946	hsa-miR-608	CLIP-seq
MIRT1108950	hsa-miR-663	CLIP-seq
MIRT1108951	hsa-miR-744	CLIP-seq
MIRT1108953	hsa-miR-765	CLIP-seq

Show/Hide all (18)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004427	Function	Inorganic diphosphate phosphatase activity	IBA
GO:0004427	Function	Inorganic diphosphate phosphatase activity	IDA	12801912
GO:0004427	Function	Inorganic diphosphate phosphatase activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183, 33961781
GO:0005634	Component	Nucleus	IDA	16430861
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA	16430861
GO:0005829	Component	Cytosol	TAS
GO:0006796	Process	Phosphate-containing compound metabolic process	IDA	12801912
GO:0016607	Component	Nuclear speck	IDA
GO:0016787	Function	Hydrolase activity	IEA
GO:0016791	Function	Phosphatase activity	IBA
GO:0016791	Function	Phosphatase activity	IEA
GO:0042803	Function	Protein homodimerization activity	IPI	12801912
GO:0046872	Function	Metal ion binding	IEA

MIM	HGNC	e!Ensembl
617231	30042	ENSG00000107902

Q9H008

Protein name

Phospholysine phosphohistidine inorganic pyrophosphate phosphatase (hLHPP) (EC 3.1.3.-) (EC 3.6.1.1)

Protein function

Phosphatase that hydrolyzes imidodiphosphate, 3-phosphohistidine and 6-phospholysine. Has broad substrate specificity and can also hydrolyze inorganic diphosphate, but with lower efficiency (By similarity).

PDB

2X4D

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13344	Hydrolase_6	14 → 116	Haloacid dehalogenase-like hydrolase	Domain
PF13242	Hydrolase_like	186 → 260		Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in brain, and at lower levels in liver and kidney. Detected in thyroid (at protein level). Expressed in liver, kidney and moderately in brain. {ECO:0000269|PubMed:12801912, ECO:0000269|PubMed:16430861}.

Sequence

MAPWGKRLAGVRGVLLDISGVLYDSGAGGGTAIAGSVEAVARLKRSRLKVRFCTNESQKS
RAELVGQLQRLGFDISEQEVTAPAPAACQILKEQGLRPYLLIHDGVRSEFDQIDTSNPNC
VVIADAGESFSYQNMNNAFQVLMELEKPVLISLGKGRYYKETSGLMLDVGPYMKALEYAC
GIKAEVVGKPSPEFFKSALQAIGVEAHQAVMIGDDIVGDVGGAQRCGMRALQVRTGKFRP
SDEHHPEVKADGYVDNLAEAVDLLLQHADK

Sequence length

270

Interactions

View interactions

	KEGG		Reactome
	Oxidative phosphorylation		Purine ribonucleoside monophosphate biosynthesis

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (15)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
B-CELL ACUTE LYMPHOBLASTIC LEUKEMIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHILDHOOD ACUTE LYMPHOBLASTIC LEUKEMIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC KIDNEY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPEN-ANGLE GLAUCOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ORAL CAVITY CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, HIP	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TESTICULAR CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TESTICULAR GERM CELL TUMOR	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNIPOLAR DEPRESSION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENOUS THROMBOEMBOLISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (37)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Asthma	Asthma	Pubtator	35858526	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bladder Neoplasm	Bladder Neoplasm	BEFREE	31262971		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	31262971, 32186702, 32404854, 32578511, 34485511	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	31693242	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	31262971		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	37321804	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	34699621, 36376886	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	29944886		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	29944886		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	36376892	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Major depressive disorder	Pubtator	26176920, 26655122	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	30912641		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	30912641		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	29452408	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	29562234, 31262971, 31693242		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	32186702	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	18268499, 26176920, 27843651, 31250265		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	PSYGENET_DG	18268499, 26176920		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	31262971		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	30912641		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	29944886		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	31190803		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	36963524	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	37023940	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	29562234, 29944886, 31190803, 31262971		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oculocutaneous albinism type 2	Oculocutaneous albinism	Pubtator	31693242	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	32186702	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor B-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	GWASCAT_DG	27694927, 29632299		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	32904557	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	36376886	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	35568711, 36376886	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular Germ Cell Tumor	GWASCAT_DG	28604732		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Unipolar Depression	Mental Depression	BEFREE	18268499, 27843651		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Unipolar Depression	Mental Depression	PSYGENET_DG	18268499, 26176920		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	31262971, 32186702	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	31262971	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitamin K Deficiency	Vitamin k deficiency	Pubtator	31693242	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only

LHPP (phospholysine phosphohistidine inorganic pyrophosphate phosphatase)