Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	64067
Gene name	Neuronal PAS domain protein 3
Gene symbol	NPAS3
Synonyms (NCBI Gene)	MOP6PASD6bHLHe12
Chromosome	14
Chromosome location	14q13.1
Summary	This gene encodes a member of the basic helix-loop-helix and PAS domain-containing family of transcription factors. The encoded protein is localized to the nucleus and may regulate genes involved in neurogenesis. Chromosomal abnormalities that affect the

193

Show/Hide all (193)

miRTarBase ID	miRNA	Experiments	Reference
MIRT623065	hsa-miR-589-3p	HITS-CLIP	23824327
MIRT616236	hsa-miR-153-5p	HITS-CLIP	23824327
MIRT616235	hsa-miR-361-3p	HITS-CLIP	23824327
MIRT616234	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT623066	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT616236	hsa-miR-153-5p	HITS-CLIP	23824327
MIRT616235	hsa-miR-361-3p	HITS-CLIP	23824327
MIRT616234	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT623066	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT616236	hsa-miR-153-5p	HITS-CLIP	23824327
MIRT616235	hsa-miR-361-3p	HITS-CLIP	23824327
MIRT616233	hsa-miR-3679-3p	HITS-CLIP	23824327
MIRT616234	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT616236	hsa-miR-153-5p	HITS-CLIP	23824327
MIRT616235	hsa-miR-361-3p	HITS-CLIP	23824327
MIRT616233	hsa-miR-3679-3p	HITS-CLIP	23824327
MIRT616234	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT623066	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT623065	hsa-miR-589-3p	HITS-CLIP	23824327
MIRT616236	hsa-miR-153-5p	HITS-CLIP	23824327
MIRT616235	hsa-miR-361-3p	HITS-CLIP	23824327
MIRT616234	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT616236	hsa-miR-153-5p	HITS-CLIP	23824327
MIRT616235	hsa-miR-361-3p	HITS-CLIP	23824327
MIRT616233	hsa-miR-3679-3p	HITS-CLIP	23824327
MIRT616234	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT623065	hsa-miR-589-3p	HITS-CLIP	23824327
MIRT616236	hsa-miR-153-5p	HITS-CLIP	23824327
MIRT616235	hsa-miR-361-3p	HITS-CLIP	23824327
MIRT616234	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT623066	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT616236	hsa-miR-153-5p	HITS-CLIP	23824327
MIRT616235	hsa-miR-361-3p	HITS-CLIP	23824327
MIRT616234	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT623066	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT616236	hsa-miR-153-5p	HITS-CLIP	23824327
MIRT616235	hsa-miR-361-3p	HITS-CLIP	23824327
MIRT616233	hsa-miR-3679-3p	HITS-CLIP	23824327
MIRT616234	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT616236	hsa-miR-153-5p	HITS-CLIP	23824327
MIRT616235	hsa-miR-361-3p	HITS-CLIP	23824327
MIRT616233	hsa-miR-3679-3p	HITS-CLIP	23824327
MIRT616234	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT623066	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT623065	hsa-miR-589-3p	HITS-CLIP	23824327
MIRT616236	hsa-miR-153-5p	HITS-CLIP	23824327
MIRT616235	hsa-miR-361-3p	HITS-CLIP	23824327
MIRT616234	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT616236	hsa-miR-153-5p	HITS-CLIP	23824327
MIRT616235	hsa-miR-361-3p	HITS-CLIP	23824327
MIRT616233	hsa-miR-3679-3p	HITS-CLIP	23824327
MIRT616234	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT1190337	hsa-miR-1	CLIP-seq
MIRT1190338	hsa-miR-103a	CLIP-seq
MIRT1190339	hsa-miR-107	CLIP-seq
MIRT1190340	hsa-miR-1179	CLIP-seq
MIRT1190341	hsa-miR-1273d	CLIP-seq
MIRT1190342	hsa-miR-127-5p	CLIP-seq
MIRT1190343	hsa-miR-128	CLIP-seq
MIRT1190344	hsa-miR-1324	CLIP-seq
MIRT1190345	hsa-miR-15a	CLIP-seq
MIRT1190346	hsa-miR-15b	CLIP-seq
MIRT1190347	hsa-miR-16	CLIP-seq
MIRT1190348	hsa-miR-183	CLIP-seq
MIRT1190349	hsa-miR-195	CLIP-seq
MIRT1190350	hsa-miR-1972	CLIP-seq
MIRT1190351	hsa-miR-206	CLIP-seq
MIRT1190352	hsa-miR-21	CLIP-seq
MIRT1190353	hsa-miR-2467-3p	CLIP-seq
MIRT1190354	hsa-miR-25	CLIP-seq
MIRT1190355	hsa-miR-3065-5p	CLIP-seq
MIRT1190356	hsa-miR-3120-5p	CLIP-seq
MIRT1190357	hsa-miR-3128	CLIP-seq
MIRT1190358	hsa-miR-3145-3p	CLIP-seq
MIRT1190359	hsa-miR-3192	CLIP-seq
MIRT1190360	hsa-miR-32	CLIP-seq
MIRT1190361	hsa-miR-3200-5p	CLIP-seq
MIRT1190362	hsa-miR-323-3p	CLIP-seq
MIRT1190363	hsa-miR-323b-5p	CLIP-seq
MIRT1190364	hsa-miR-326	CLIP-seq
MIRT1190365	hsa-miR-330-5p	CLIP-seq
MIRT1190366	hsa-miR-3614-5p	CLIP-seq
MIRT1190367	hsa-miR-3617	CLIP-seq
MIRT1190368	hsa-miR-363	CLIP-seq
MIRT1190369	hsa-miR-3664-3p	CLIP-seq
MIRT1190370	hsa-miR-367	CLIP-seq
MIRT1190371	hsa-miR-3689a-5p	CLIP-seq
MIRT1190372	hsa-miR-3689b	CLIP-seq
MIRT1190373	hsa-miR-3689e	CLIP-seq
MIRT1190374	hsa-miR-3689f	CLIP-seq
MIRT1190375	hsa-miR-377	CLIP-seq
MIRT1190376	hsa-miR-3914	CLIP-seq
MIRT1190377	hsa-miR-424	CLIP-seq
MIRT1190378	hsa-miR-4269	CLIP-seq
MIRT1190379	hsa-miR-4272	CLIP-seq
MIRT1190380	hsa-miR-4303	CLIP-seq
MIRT1190381	hsa-miR-4314	CLIP-seq
MIRT1190382	hsa-miR-4457	CLIP-seq
MIRT1190383	hsa-miR-4475	CLIP-seq
MIRT1190384	hsa-miR-4477a	CLIP-seq
MIRT1190385	hsa-miR-4522	CLIP-seq
MIRT1190386	hsa-miR-4643	CLIP-seq
MIRT1190387	hsa-miR-4645-3p	CLIP-seq
MIRT1190388	hsa-miR-4645-5p	CLIP-seq
MIRT1190389	hsa-miR-4646-5p	CLIP-seq
MIRT1190390	hsa-miR-466	CLIP-seq
MIRT1190391	hsa-miR-4670-3p	CLIP-seq
MIRT1190392	hsa-miR-4673	CLIP-seq
MIRT1190393	hsa-miR-4698	CLIP-seq
MIRT1190394	hsa-miR-4720-5p	CLIP-seq
MIRT1190395	hsa-miR-4755-3p	CLIP-seq
MIRT1190396	hsa-miR-4789-3p	CLIP-seq
MIRT1190397	hsa-miR-4789-5p	CLIP-seq
MIRT1190398	hsa-miR-4799-3p	CLIP-seq
MIRT1190399	hsa-miR-496	CLIP-seq
MIRT1190400	hsa-miR-497	CLIP-seq
MIRT1190401	hsa-miR-510	CLIP-seq
MIRT1190402	hsa-miR-513a-5p	CLIP-seq
MIRT1190403	hsa-miR-554	CLIP-seq
MIRT1190404	hsa-miR-590-5p	CLIP-seq
MIRT1190405	hsa-miR-607	CLIP-seq
MIRT1190406	hsa-miR-613	CLIP-seq
MIRT1190407	hsa-miR-630	CLIP-seq
MIRT1190408	hsa-miR-641	CLIP-seq
MIRT1190409	hsa-miR-642b	CLIP-seq
MIRT1190410	hsa-miR-656	CLIP-seq
MIRT1190411	hsa-miR-660	CLIP-seq
MIRT1190412	hsa-miR-668	CLIP-seq
MIRT1190413	hsa-miR-671-3p	CLIP-seq
MIRT1190414	hsa-miR-873	CLIP-seq
MIRT1190415	hsa-miR-889	CLIP-seq
MIRT1190416	hsa-miR-92a	CLIP-seq
MIRT1190417	hsa-miR-92b	CLIP-seq
MIRT1190418	hsa-miR-936	CLIP-seq
MIRT1190338	hsa-miR-103a	CLIP-seq
MIRT1190339	hsa-miR-107	CLIP-seq
MIRT2055115	hsa-miR-27a	CLIP-seq
MIRT2055116	hsa-miR-27b	CLIP-seq
MIRT2055117	hsa-miR-3125	CLIP-seq
MIRT2055118	hsa-miR-3616-5p	CLIP-seq
MIRT2055119	hsa-miR-3647-5p	CLIP-seq
MIRT2055120	hsa-miR-3916	CLIP-seq
MIRT2055121	hsa-miR-4311	CLIP-seq
MIRT2055122	hsa-miR-4328	CLIP-seq
MIRT2055123	hsa-miR-4476	CLIP-seq
MIRT2055124	hsa-miR-4795-3p	CLIP-seq
MIRT2055125	hsa-miR-4795-5p	CLIP-seq
MIRT1190402	hsa-miR-513a-5p	CLIP-seq
MIRT2055126	hsa-miR-543	CLIP-seq
MIRT2055127	hsa-miR-548ag	CLIP-seq
MIRT2055128	hsa-miR-548ai	CLIP-seq
MIRT2055129	hsa-miR-548m	CLIP-seq
MIRT2055130	hsa-miR-573	CLIP-seq
MIRT2284073	hsa-miR-1226	CLIP-seq
MIRT2055115	hsa-miR-27a	CLIP-seq
MIRT2055116	hsa-miR-27b	CLIP-seq
MIRT1190367	hsa-miR-3617	CLIP-seq
MIRT1190402	hsa-miR-513a-5p	CLIP-seq
MIRT2055126	hsa-miR-543	CLIP-seq
MIRT1190408	hsa-miR-641	CLIP-seq
MIRT2284074	hsa-miR-1197	CLIP-seq
MIRT2284075	hsa-miR-1229	CLIP-seq
MIRT2284076	hsa-miR-2277-3p	CLIP-seq
MIRT1190362	hsa-miR-323-3p	CLIP-seq
MIRT2284077	hsa-miR-342-3p	CLIP-seq
MIRT1190369	hsa-miR-3664-3p	CLIP-seq
MIRT1190375	hsa-miR-377	CLIP-seq
MIRT2284078	hsa-miR-412	CLIP-seq
MIRT1190378	hsa-miR-4269	CLIP-seq
MIRT2284079	hsa-miR-4277	CLIP-seq
MIRT1190386	hsa-miR-4643	CLIP-seq
MIRT1190388	hsa-miR-4645-5p	CLIP-seq
MIRT1190390	hsa-miR-466	CLIP-seq
MIRT1190391	hsa-miR-4670-3p	CLIP-seq
MIRT1190392	hsa-miR-4673	CLIP-seq
MIRT1190395	hsa-miR-4755-3p	CLIP-seq
MIRT1190396	hsa-miR-4789-3p	CLIP-seq
MIRT1190401	hsa-miR-510	CLIP-seq
MIRT2284080	hsa-miR-582-5p	CLIP-seq
MIRT1190409	hsa-miR-642b	CLIP-seq
MIRT1190413	hsa-miR-671-3p	CLIP-seq
MIRT1190414	hsa-miR-873	CLIP-seq
MIRT1190355	hsa-miR-3065-5p	CLIP-seq
MIRT1190357	hsa-miR-3128	CLIP-seq
MIRT2455341	hsa-miR-3175	CLIP-seq
MIRT2455342	hsa-miR-4419a	CLIP-seq
MIRT2455343	hsa-miR-4510	CLIP-seq
MIRT2455344	hsa-miR-4709-3p	CLIP-seq
MIRT2455345	hsa-miR-4716-3p	CLIP-seq
MIRT1190394	hsa-miR-4720-5p	CLIP-seq
MIRT2455346	hsa-miR-4723-5p	CLIP-seq
MIRT2455347	hsa-miR-4779	CLIP-seq
MIRT1190398	hsa-miR-4799-3p	CLIP-seq

Show/Hide all (14)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0003677	Function	DNA binding	IEA
GO:0005515	Function	Protein binding	IPI	24722188, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0045893	Process	Positive regulation of DNA-templated transcription	ISS
GO:0046982	Function	Protein heterodimerization activity	ISS
GO:0046983	Function	Protein dimerization activity	IEA

MIM	HGNC	e!Ensembl
609430	19311	ENSG00000151322

Q8IXF0

Protein name

Neuronal PAS domain-containing protein 3 (Neuronal PAS3) (Basic-helix-loop-helix-PAS protein MOP6) (Class E basic helix-loop-helix protein 12) (bHLHe12) (Member of PAS protein 6) (PAS domain-containing protein 6)

Protein function

May play a broad role in neurogenesis. May control regulatory pathways relevant to schizophrenia and to psychotic illness (By similarity).

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00989	PAS	150 → 229	PAS fold	Domain
PF08447	PAS_3	343 → 430	PAS fold	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitously expressed in the adult brain.

Sequence

MAPTKPSFQQDPSRRERITAQHPLPNQSECRKIYRYDGIYCESTYQNLQALRKEKSRDAA
RSRRGKENFEFYELAKLLPLPAAITSQLDKASIIRLTISYLKMRDFANQGDPPWNLRMEG
PPPNTSVKVIGAQRRRSPSALAIEVFEAHLGSHILQSLDGFVFALNQEGKFLYISETVSI
YLGLSQVELTGSSVFDYVHPGDHVEMAEQLGMKLPPGRGLLSQGTAEDGASSASSSSQSE
TPEPVESTSPSLLTTDNTLERSFFIRMKSTLTKRGVHIKSSGYKVIHITGRLRLRVSLSH
GRTVPSQIMGLVVVAHALPPPTINEVRIDCHMFVTRVNMDLNIIYCENRISDYMDLTPVD
IVGKRCYHFIHAEDVEGIRHSHLDLLNKGQCVTKYYRWMQKNGGYIWIQSSATIAINAKN
ANEKNIIWVNYLLSNPEYKDTPMDIAQLPHLPEKTSESSETSDSESDSKDTSGITEDNEN
SKSDEKGNQSENSEDPEPDRKKSGNACDNDMNCNDDGHSSSNPDSRDSDDSFEHSDFENP
KAGEDGFGALGAMQIKVERYVESESDLRLQNCESLTSDSAKDSDSAGEAGAQASSKHQKR
KKRRKRQKGGSASRRRLSSASSPGGLDAGLVEPPRLLSSPNSASVLKIKTEISEPINFDN
DSSIWNYPPNREISRNESPYSMTKPPSSEHFPSPQGGGGGGGGGGGLHVAIPDSVLTPPG
ADGAAARKTQFGASATAALAPVASDPLSPPLSASPRDKHPGNGGGGGGGGGGAGGGGPSA
SNSLLYTGDLEALQRLQAGNVVLPLVHRVTGTLAATSTAAQRVYTTGTIRYAPAEVTLAM
QSNLLPNAHAVNFVDVNSPGFGLDPKTPMEMLYHHVHRLNMSGPFGGAVSAASLTQMPAG
NVFTTAEGLFSTLPFPVYSNGIHAAQTLERKED

Sequence length

933

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (31)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANKYLOSING SPONDYLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANOREXIA NERVOSA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRONCHIAL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL NEOPLASM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL OR BEHAVIOURAL DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NONORGANIC PSYCHOSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBSESSIVE-COMPULSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN NEOPLASM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHOTIC DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TOURETTE SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNIPOLAR DEPRESSION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UPPER AERODIGESTIVE TRACT NEOPLASM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (38)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Alzheimer Disease	Alzheimer disease	Pubtator	36982982	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Angelman Syndrome	Angelman Syndrome	BEFREE	28499489		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	21703424		★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder with Hyperactivity	Attention deficit hyperactivity disorder	Pubtator	21654738	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	27782878	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	BEFREE	18317462		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	18317462, 20713499, 24718920		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar disorder	Pubtator	20713499, 21654738, 27782878	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Borderline Personality Disorder	Borderline personality disorder	BEFREE	21654738		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	24674381	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	39201344	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	21654738		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Major depressive disorder	Pubtator	20713499	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	33758288	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	21703424		★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	23628382	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	19073416, 19073419, 20215773		★★★★★ ★☆☆☆☆ Found in Text Mining only
Learning Disabilities	Learning Disorders	BEFREE	15924306		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	20713499		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	PSYGENET_DG	20713499		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant Glioma	Glioma	BEFREE	21703424		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	23825647		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	12746393, 17008307, 18317462, 22228753, 28499489		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Retardation	Mental retardation	BEFREE	19073416, 19073419, 20215773		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	23628382	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neoplasms	Neoplasms	BEFREE	21703424		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodevelopmental Disorders	Neurodevelopmental Disorders	BEFREE	30509165		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	19073419, 20466522		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonorganic psychosis	Nonorganic Psychosis	PSYGENET_DG	20466522		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psychotic Disorders	Psychosis	BEFREE	19073419, 20466522		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psychotic Disorders	Psychosis	PSYGENET_DG	20466522		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	BEFREE	12746393, 15924306, 17468935, 18317462, 18521090, 20466522, 20713499, 22228753, 24674381, 25982957		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	LHGDN	12746393		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	12746393, 20713499, 22228753, 24674381, 27782878, 33758288, 36982982	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	18317462, 20466522, 20713499, 24674381		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma of lung	Lung carcinoma	GWASCAT_DG	28604730		★★★★★ ★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	20713499		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Unipolar Depression	Mental Depression	PSYGENET_DG	20713499		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

NPAS3 (neuronal PAS domain protein 3)