SEMA3F (semaphorin 3F)

Gene

• Entrez ID: 6405
• Gene name: Semaphorin 3F
• Gene symbol: SEMA3F
• Synonyms (NCBI Gene): SEMA-IV, SEMA4, SEMAK
• Chromosome: 3
• Chromosome location: 3p21.31
• Summary: This gene encodes a member of the semaphorin III family of secreted signaling proteins that are involved in axon guidance during neuronal development. The encoded protein contains an N-terminal Sema domain, an immunoglobulin loop and a C-terminal basic do

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT519572	hsa-miR-5011-5p	HITS-CLIP	23313552
MIRT697191	hsa-miR-3145-3p	HITS-CLIP	23313552
MIRT519571	hsa-miR-190a-3p	HITS-CLIP	23313552
MIRT519569	hsa-miR-6083	HITS-CLIP	23313552
MIRT519570	hsa-miR-1277-5p	HITS-CLIP	23313552
MIRT519572	hsa-miR-5011-5p	HITS-CLIP	23313552
MIRT519571	hsa-miR-190a-3p	HITS-CLIP	23313552
MIRT519569	hsa-miR-6083	HITS-CLIP	23313552
MIRT519570	hsa-miR-1277-5p	HITS-CLIP	23313552
MIRT519572	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT612269	hsa-miR-656-3p	HITS-CLIP	23824327
MIRT519571	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT519569	hsa-miR-6083	HITS-CLIP	23824327
MIRT519570	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT519572	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT612269	hsa-miR-656-3p	HITS-CLIP	23824327
MIRT519571	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT519569	hsa-miR-6083	HITS-CLIP	23824327
MIRT519570	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT519572	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT612269	hsa-miR-656-3p	HITS-CLIP	23824327
MIRT519571	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT519569	hsa-miR-6083	HITS-CLIP	23824327
MIRT519570	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT519572	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT519571	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT519569	hsa-miR-6083	PAR-CLIP	23446348
MIRT519570	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT491753	hsa-miR-3154	PAR-CLIP	23592263
MIRT491752	hsa-miR-6085	PAR-CLIP	23592263
MIRT491751	hsa-miR-6813-5p	PAR-CLIP	23592263
MIRT491750	hsa-miR-3937	PAR-CLIP	23592263
MIRT491749	hsa-miR-6777-5p	PAR-CLIP	23592263
MIRT491747	hsa-miR-6889-5p	PAR-CLIP	23592263
MIRT491748	hsa-miR-3179	PAR-CLIP	23592263
MIRT491746	hsa-miR-6770-5p	PAR-CLIP	23592263
MIRT491745	hsa-miR-4755-3p	PAR-CLIP	23592263
MIRT491744	hsa-miR-4706	PAR-CLIP	23592263
MIRT491743	hsa-miR-4749-5p	PAR-CLIP	23592263
MIRT491742	hsa-miR-4434	PAR-CLIP	23592263
MIRT491741	hsa-miR-4516	PAR-CLIP	23592263
MIRT491740	hsa-miR-5703	PAR-CLIP	23592263
MIRT491739	hsa-miR-1908-5p	PAR-CLIP	23592263
MIRT491738	hsa-miR-663a	PAR-CLIP	23592263
MIRT491737	hsa-miR-6787-5p	PAR-CLIP	23592263
MIRT491736	hsa-miR-6878-5p	PAR-CLIP	23592263
MIRT491735	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT491733	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT491734	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT491732	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT491731	hsa-miR-4656	PAR-CLIP	23592263
MIRT491730	hsa-miR-185-3p	PAR-CLIP	23592263
MIRT519572	hsa-miR-5011-5p	HITS-CLIP	23313552
MIRT697191	hsa-miR-3145-3p	HITS-CLIP	23313552
MIRT519571	hsa-miR-190a-3p	HITS-CLIP	23313552
MIRT519569	hsa-miR-6083	HITS-CLIP	23313552
MIRT519570	hsa-miR-1277-5p	HITS-CLIP	23313552
MIRT519572	hsa-miR-5011-5p	HITS-CLIP	23313552
MIRT519571	hsa-miR-190a-3p	HITS-CLIP	23313552
MIRT519569	hsa-miR-6083	HITS-CLIP	23313552
MIRT519570	hsa-miR-1277-5p	HITS-CLIP	23313552
MIRT519572	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT612269	hsa-miR-656-3p	HITS-CLIP	23824327
MIRT519571	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT519569	hsa-miR-6083	HITS-CLIP	23824327
MIRT519570	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT519572	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT612269	hsa-miR-656-3p	HITS-CLIP	23824327
MIRT519571	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT519569	hsa-miR-6083	HITS-CLIP	23824327
MIRT519570	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT519572	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT612269	hsa-miR-656-3p	HITS-CLIP	23824327
MIRT519571	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT519569	hsa-miR-6083	HITS-CLIP	23824327
MIRT519570	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT519572	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT519571	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT519569	hsa-miR-6083	PAR-CLIP	23446348
MIRT519570	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT491753	hsa-miR-3154	PAR-CLIP	23592263
MIRT491752	hsa-miR-6085	PAR-CLIP	23592263
MIRT491751	hsa-miR-6813-5p	PAR-CLIP	23592263
MIRT491750	hsa-miR-3937	PAR-CLIP	23592263
MIRT491749	hsa-miR-6777-5p	PAR-CLIP	23592263
MIRT491747	hsa-miR-6889-5p	PAR-CLIP	23592263
MIRT491748	hsa-miR-3179	PAR-CLIP	23592263
MIRT491746	hsa-miR-6770-5p	PAR-CLIP	23592263
MIRT491745	hsa-miR-4755-3p	PAR-CLIP	23592263
MIRT491744	hsa-miR-4706	PAR-CLIP	23592263
MIRT491743	hsa-miR-4749-5p	PAR-CLIP	23592263
MIRT491742	hsa-miR-4434	PAR-CLIP	23592263
MIRT491741	hsa-miR-4516	PAR-CLIP	23592263
MIRT491740	hsa-miR-5703	PAR-CLIP	23592263
MIRT491739	hsa-miR-1908-5p	PAR-CLIP	23592263
MIRT491738	hsa-miR-663a	PAR-CLIP	23592263
MIRT491737	hsa-miR-6787-5p	PAR-CLIP	23592263
MIRT491736	hsa-miR-6878-5p	PAR-CLIP	23592263
MIRT491735	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT491733	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT491734	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT491732	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT491731	hsa-miR-4656	PAR-CLIP	23592263
MIRT491730	hsa-miR-185-3p	PAR-CLIP	23592263
MIRT1334970	hsa-let-7a	CLIP-seq
MIRT1334971	hsa-let-7b	CLIP-seq
MIRT1334972	hsa-let-7c	CLIP-seq
MIRT1334973	hsa-let-7d	CLIP-seq
MIRT1334974	hsa-let-7e	CLIP-seq
MIRT1334975	hsa-let-7f	CLIP-seq
MIRT1334976	hsa-let-7g	CLIP-seq
MIRT1334977	hsa-let-7i	CLIP-seq
MIRT1334978	hsa-miR-2682	CLIP-seq
MIRT1334979	hsa-miR-2861	CLIP-seq
MIRT1334980	hsa-miR-3153	CLIP-seq
MIRT1334981	hsa-miR-3155	CLIP-seq
MIRT1334982	hsa-miR-3155b	CLIP-seq
MIRT1334983	hsa-miR-3173-3p	CLIP-seq
MIRT1334984	hsa-miR-342-5p	CLIP-seq
MIRT1334985	hsa-miR-3927	CLIP-seq
MIRT1334986	hsa-miR-4423-3p	CLIP-seq
MIRT1334987	hsa-miR-4428	CLIP-seq
MIRT1334988	hsa-miR-4451	CLIP-seq
MIRT1334989	hsa-miR-4458	CLIP-seq
MIRT1334990	hsa-miR-4481	CLIP-seq
MIRT1334991	hsa-miR-449c	CLIP-seq
MIRT1334992	hsa-miR-4500	CLIP-seq
MIRT1334993	hsa-miR-4521	CLIP-seq
MIRT1334994	hsa-miR-4651	CLIP-seq
MIRT1334995	hsa-miR-4664-5p	CLIP-seq
MIRT1334996	hsa-miR-4745-5p	CLIP-seq
MIRT1334997	hsa-miR-484	CLIP-seq
MIRT1334998	hsa-miR-608	CLIP-seq
MIRT1334999	hsa-miR-760	CLIP-seq
MIRT1335000	hsa-miR-940	CLIP-seq
MIRT1335001	hsa-miR-98	CLIP-seq
MIRT2099028	hsa-miR-1225-3p	CLIP-seq
MIRT2099029	hsa-miR-1827	CLIP-seq
MIRT2099030	hsa-miR-193a-5p	CLIP-seq
MIRT2099031	hsa-miR-3138	CLIP-seq
MIRT2099032	hsa-miR-3165	CLIP-seq
MIRT2099033	hsa-miR-331-3p	CLIP-seq
MIRT2099034	hsa-miR-338-3p	CLIP-seq
MIRT2099035	hsa-miR-3605-5p	CLIP-seq
MIRT2099036	hsa-miR-3616-5p	CLIP-seq
MIRT2099037	hsa-miR-3647-5p	CLIP-seq
MIRT2099038	hsa-miR-3921	CLIP-seq
MIRT2099039	hsa-miR-3943	CLIP-seq
MIRT2099040	hsa-miR-4252	CLIP-seq
MIRT2099041	hsa-miR-4256	CLIP-seq
MIRT2099042	hsa-miR-4272	CLIP-seq
MIRT2099043	hsa-miR-4443	CLIP-seq
MIRT2099044	hsa-miR-4649-3p	CLIP-seq
MIRT2099045	hsa-miR-4653-5p	CLIP-seq
MIRT2099046	hsa-miR-4727-5p	CLIP-seq
MIRT2099047	hsa-miR-4733-3p	CLIP-seq
MIRT2099048	hsa-miR-4795-5p	CLIP-seq
MIRT2099049	hsa-miR-544	CLIP-seq
MIRT2099050	hsa-miR-573	CLIP-seq
MIRT2099051	hsa-miR-593	CLIP-seq
MIRT2099052	hsa-miR-634	CLIP-seq
MIRT2099053	hsa-miR-665	CLIP-seq
MIRT1334999	hsa-miR-760	CLIP-seq
MIRT2099054	hsa-miR-765	CLIP-seq
MIRT1335000	hsa-miR-940	CLIP-seq
MIRT2323826	hsa-miR-214	CLIP-seq
MIRT2099034	hsa-miR-338-3p	CLIP-seq
MIRT2323827	hsa-miR-3529	CLIP-seq
MIRT2323828	hsa-miR-3619-5p	CLIP-seq
MIRT2323829	hsa-miR-379	CLIP-seq
MIRT1334985	hsa-miR-3927	CLIP-seq
MIRT2323830	hsa-miR-4530	CLIP-seq
MIRT2323831	hsa-miR-617	CLIP-seq
MIRT2323832	hsa-miR-761	CLIP-seq
MIRT2099038	hsa-miR-3921	CLIP-seq
MIRT2099041	hsa-miR-4256	CLIP-seq
MIRT2099045	hsa-miR-4653-5p	CLIP-seq
MIRT2099046	hsa-miR-4727-5p	CLIP-seq
MIRT2099049	hsa-miR-544	CLIP-seq
MIRT2099051	hsa-miR-593	CLIP-seq
MIRT2099052	hsa-miR-634	CLIP-seq
MIRT2099038	hsa-miR-3921	CLIP-seq
MIRT2099041	hsa-miR-4256	CLIP-seq
MIRT2099045	hsa-miR-4653-5p	CLIP-seq
MIRT2099046	hsa-miR-4727-5p	CLIP-seq
MIRT2099049	hsa-miR-544	CLIP-seq
MIRT2099051	hsa-miR-593	CLIP-seq
MIRT2099052	hsa-miR-634	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001755	Process	Neural crest cell migration	IBA
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	TAS	8786119
GO:0005886	Component	Plasma membrane	IBA
GO:0007165	Process	Signal transduction	IEA
GO:0007411	Process	Axon guidance	IBA
GO:0007411	Process	Axon guidance	IDA	15814794
GO:0007411	Process	Axon guidance	IEA
GO:0021612	Process	Facial nerve structural organization	IEA
GO:0021612	Process	Facial nerve structural organization	ISS
GO:0021637	Process	Trigeminal nerve structural organization	IEA
GO:0021637	Process	Trigeminal nerve structural organization	ISS
GO:0021675	Process	Nerve development	IEA
GO:0021675	Process	Nerve development	ISS
GO:0021785	Process	Branchiomotor neuron axon guidance	IEA
GO:0021785	Process	Branchiomotor neuron axon guidance	ISS
GO:0030215	Function	Semaphorin receptor binding	IBA
GO:0030215	Function	Semaphorin receptor binding	IEA
GO:0030335	Process	Positive regulation of cell migration	IBA
GO:0036484	Process	Trunk neural crest cell migration	IEA
GO:0036486	Process	Ventral trunk neural crest cell migration	IEA
GO:0038191	Function	Neuropilin binding	IBA
GO:0045499	Function	Chemorepellent activity	IBA
GO:0045499	Function	Chemorepellent activity	IDA	15814794
GO:0045499	Function	Chemorepellent activity	IEA
GO:0048731	Process	System development	IEA
GO:0048843	Process	Negative regulation of axon extension involved in axon guidance	IEA
GO:0048846	Process	Axon extension involved in axon guidance	IEA
GO:0048846	Process	Axon extension involved in axon guidance	ISS
GO:0050919	Process	Negative chemotaxis	IBA
GO:0050919	Process	Negative chemotaxis	IEA
GO:0061549	Process	Sympathetic ganglion development	IEA
GO:0061549	Process	Sympathetic ganglion development	ISS
GO:0071526	Process	Semaphorin-plexin signaling pathway	IBA
GO:0071526	Process	Semaphorin-plexin signaling pathway	IEA
GO:0071526	Process	Semaphorin-plexin signaling pathway	ISS
GO:0097490	Process	Sympathetic neuron projection extension	IEA
GO:0097490	Process	Sympathetic neuron projection extension	ISS
GO:0097491	Process	Sympathetic neuron projection guidance	IEA
GO:0097491	Process	Sympathetic neuron projection guidance	ISS
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0099175	Process	Regulation of postsynapse organization	IEA
GO:1901166	Process	Neural crest cell migration involved in autonomic nervous system development	IEA

Other IDs

• MIM: 601124
• HGNC: 10728
• e!Ensembl: ENSG00000001617

Protein

• UniProt ID: Q13275
• Protein name: Semaphorin-3F (Sema III/F) (Semaphorin IV) (Sema IV)
• Protein function: May play a role in cell motility and cell adhesion.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01403	Sema	59 → 527	Sema domain	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed abundantly but differentially in a variety of neural and nonneural tissues. There is high expression in mammary gland, kidney, fetal brain, and lung and lower expression in heart and liver.
• Sequence:

  MLVAGLLLWASLLTGAWPSFPTQDHLPATPRVRLSFKELKATGTAHFFNFLLNTTDYRIL
  LKDEDHDRMYVGSKDYVLSLDLHDINREPLIIHWAASPQRIEECVLSGKDVNGECGNFVR
  LIQPWNRTHLYVCGTGAYNPMCTYVNRGRRAQATPWTQTQAVRGRGSRATDGALRPMPTA
  PRQDYIFYLEPERLESGKGKCPYDPKLDTASALINEELYAGVYIDFMGTDAAIFRTLGKQ
  TAMRTDQYNSRWLNDPSFIHAELIPDSAERNDDKLYFFFRERSAEAPQSPAVYARIGRIC
  LNDDGGHCCLVNKWSTFLKARLVCSVPGEDGIETHFDELQDVFVQQTQDVRNPVIYAVFT
  SSGSVFRGSAVCVYSMADIRMVFNGPFAHKEGPNYQWMPFSGKMPYPRPGTCPGGTFTPS
  MKSTKDYPDEVINFMRSHPLMYQAVYPLQRRPLVVRTGAPYRLTTIAVDQVDAADGRYEV
  LFLGTDRGTVQKVIVLPKDDQELEELMLEEVEVFKDPAPVKTMTISSKRQQLYVASAVGV
  THLSLHRCQAYGAACADCCLARDPYCAWDGQACSRYTASSKRRSRRQDVRHGNPIRQCRG
  FNSNANKNAVESVQYGVAGSAAFLECQPRSPQATVKWLFQRDPGDRRREIRAEDRFLRTE
  QGLLLRALQLSDRGLYSCTATENNFKHVVTRVQLHVLGRDAVHAALFPPLSMSAPPPPGA
  GPPTPPYQELAQLLAQPEVGLIHQYCQGYWRHVPPSPREAPGAPRSPEPQDQKKPRNRRH
  HPPDT

• Sequence length: 785

Pathways

KEGG:

Axon guidance

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Acute myeloid leukemia	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANOREXIA NERVOSA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANNABIS DEPENDENCE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DYSLEXIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROESOPHAGEAL REFLUX DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hearing impairment	Uncertain significance	ClinVar Disgenet	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Hypogonadotropic hypogonadism	Uncertain significance; Affects	ClinVar ClinVar, Disgenet ClinVar, Disgenet	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
INSOMNIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PEPTIC ULCER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POST-TRAUMATIC STRESS DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEMA3F-related disorder	Uncertain significance; Conflicting classifications of pathogenicity; Likely benign; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenoma of large intestine	Colorectal adenoma	BEFREE	22093159		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	29415226, 30635860		★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	BEFREE	17010410		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	28698137		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	22431917		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	15802023, 22350413, 26784191		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	26784191	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	26722466, 30696738, 32297576, 39232098	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	17010410		★☆☆☆☆ Found in Text Mining only
Carcinoma Adenoid Cystic	Adenoid cystic carcinoma	Pubtator	28961428	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	10702410, 11717452, 12771950, 12845630, 15208675, 15802023, 17308083, 17875711, 19177200, 24121493, 8786119		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	21349996		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	21349996, 25529012, 25543087, 25866254, 26722466		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	25193853, 33109776	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	26722466	Inhibit	★☆☆☆☆ Found in Text Mining only
Corneal Neovascularization	Corneal Neovascularization	BEFREE	30383199		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	30877507		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	19787205		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	21933904, 31215376		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	CTD_human_DG	21933904		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	CTD_human_DG	21933904		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	21933904	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	31215376, 32297576	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	32441221	Inhibit	★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	38034016	Associate	★☆☆☆☆ Found in Text Mining only
Hemangioma capillary infantile	Capillary infantile hemangioma	Pubtator	26086095	Inhibit	★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung disease	Pubtator	30663199	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	19787205		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	19177200, 21610314	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic Hypogonadotropic Hypogonadism	Hypogonadotropic hypogonadism	Pubtator	33495532	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	10702410		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	10702410, 12845630	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	15967098		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	19177200	Inhibit	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	32441221	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	25068647	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	15802023, 22350413, 26784191		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	21933904, 31215376		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	10702410, 11717452, 12771950, 12845630, 15208675, 15802023, 17308083, 17875711, 19177200, 24121493, 8786119		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	19683737, 28698137		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	21933904, 25529012, 25952650, 29299034		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	21349996		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	20036365, 20198310		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11717452, 11980661, 12659673, 12771950, 12845630, 17308083, 17875711, 19683737, 21842119, 22431917, 22562223, 24121493, 25543087, 25952650, 26156437, 26447612, 26722466, 29299034, 30532711, 31215376, 31223439, 8633026		★☆☆☆☆ Found in Text Mining only
Neurilemmoma	Neurilemmoma	BEFREE	22431917		★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	26447612		★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 2	Neurofibromatosis	BEFREE	22431917		★☆☆☆☆ Found in Text Mining only
Neuroma	Neuroma	BEFREE	18160633		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	20124444	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	38203854	Associate	★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	25068647		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	19683737, 28698137		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	11980661, 8633026		★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	8633026	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	25952650, 29299034		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	28602571		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	28052040	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	36737753	Associate	★☆☆☆☆ Found in Text Mining only