Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	6403
Gene name	Selectin P
Gene symbol	SELP
Synonyms (NCBI Gene)	CD62CD62PGMP140GRMPLECAM3PADGEMPSEL
Chromosome	1
Chromosome location	1q24.2
Summary	This gene encodes a 140 kDa protein that is stored in the alpha-granules of platelets and Weibel-Palade bodies of endothelial cells. This protein redistributes to the plasma membrane during platelet activation and degranulation and mediates the interactio

Show/Hide all (1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs730880284	C>G,T	Likely-pathogenic	Splice donor variant

Show/Hide all (47)

miRTarBase ID	miRNA	Experiments	Reference
MIRT735899	hsa-miR-1233-5p	Flow cytometry	32485903
MIRT755612	hsa-miR-27a-3p	qRT-PCR	35144666
MIRT1334306	hsa-miR-125a-3p	CLIP-seq
MIRT1334307	hsa-miR-1297	CLIP-seq
MIRT1334308	hsa-miR-1299	CLIP-seq
MIRT1334309	hsa-miR-1304	CLIP-seq
MIRT1334310	hsa-miR-134	CLIP-seq
MIRT1334311	hsa-miR-194	CLIP-seq
MIRT1334312	hsa-miR-221	CLIP-seq
MIRT1334313	hsa-miR-222	CLIP-seq
MIRT1334314	hsa-miR-26a	CLIP-seq
MIRT1334315	hsa-miR-26b	CLIP-seq
MIRT1334316	hsa-miR-3065-5p	CLIP-seq
MIRT1334317	hsa-miR-3118	CLIP-seq
MIRT1334318	hsa-miR-3126-5p	CLIP-seq
MIRT1334319	hsa-miR-3160-5p	CLIP-seq
MIRT1334320	hsa-miR-326	CLIP-seq
MIRT1334321	hsa-miR-330-5p	CLIP-seq
MIRT1334322	hsa-miR-4419a	CLIP-seq
MIRT1334323	hsa-miR-4420	CLIP-seq
MIRT1334324	hsa-miR-4434	CLIP-seq
MIRT1334325	hsa-miR-4465	CLIP-seq
MIRT1334326	hsa-miR-4510	CLIP-seq
MIRT1334327	hsa-miR-4516	CLIP-seq
MIRT1334328	hsa-miR-4531	CLIP-seq
MIRT1334329	hsa-miR-4700-3p	CLIP-seq
MIRT1334330	hsa-miR-4774-5p	CLIP-seq
MIRT1334331	hsa-miR-4796-3p	CLIP-seq
MIRT1334332	hsa-miR-498	CLIP-seq
MIRT1334333	hsa-miR-508-5p	CLIP-seq
MIRT1334334	hsa-miR-520g	CLIP-seq
MIRT1334335	hsa-miR-520h	CLIP-seq
MIRT1334336	hsa-miR-548v	CLIP-seq
MIRT1334337	hsa-miR-552	CLIP-seq
MIRT1334338	hsa-miR-579	CLIP-seq
MIRT1334339	hsa-miR-671-5p	CLIP-seq
MIRT1334340	hsa-miR-802	CLIP-seq
MIRT1334341	hsa-miR-875-3p	CLIP-seq
MIRT1334316	hsa-miR-3065-5p	CLIP-seq
MIRT2323739	hsa-miR-3158-5p	CLIP-seq
MIRT1334319	hsa-miR-3160-5p	CLIP-seq
MIRT1334324	hsa-miR-4434	CLIP-seq
MIRT1334327	hsa-miR-4516	CLIP-seq
MIRT1334328	hsa-miR-4531	CLIP-seq
MIRT1334331	hsa-miR-4796-3p	CLIP-seq
MIRT1334334	hsa-miR-520g	CLIP-seq
MIRT1334335	hsa-miR-520h	CLIP-seq

Show/Hide all (2)

Transcription factor	Regulation	Reference
NFKB2	Activation	7559449
STAT6	Activation	10364072

Show/Hide all (53)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001530	Function	Lipopolysaccharide binding	IMP	16514062
GO:0002687	Process	Positive regulation of leukocyte migration	IEA
GO:0005178	Function	Integrin binding	IDA	37184585
GO:0005509	Function	Calcium ion binding	IDA	11081633
GO:0005515	Function	Protein binding	IPI	9129046, 11081633, 11237770, 15633604, 18606703, 19118202, 26627825, 28011641, 37184585
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	9290466
GO:0005886	Component	Plasma membrane	IDA	28011641
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	1701178
GO:0006954	Process	Inflammatory response	IEA
GO:0007155	Process	Cell adhesion	IEA
GO:0007155	Process	Cell adhesion	TAS	2466574
GO:0007157	Process	Heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules	IBA
GO:0007157	Process	Heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules	IEA
GO:0007159	Process	Leukocyte cell-cell adhesion	IDA	7680663
GO:0007159	Process	Leukocyte cell-cell adhesion	IEA
GO:0008201	Function	Heparin binding	IDA	7680663
GO:0009897	Component	External side of plasma membrane	IBA
GO:0009897	Component	External side of plasma membrane	IDA	16514062
GO:0009897	Component	External side of plasma membrane	IEA
GO:0010572	Process	Positive regulation of platelet activation	IEA
GO:0010572	Process	Positive regulation of platelet activation	ISS	16514062
GO:0016020	Component	Membrane	IEA
GO:0016339	Process	Calcium-dependent cell-cell adhesion via plasma membrane cell adhesion molecules	IMP	28011641
GO:0030246	Function	Carbohydrate binding	IEA
GO:0031088	Component	Platelet dense granule membrane	TAS
GO:0031092	Component	Platelet alpha granule membrane	IDA	15297306
GO:0031092	Component	Platelet alpha granule membrane	TAS
GO:0032496	Process	Response to lipopolysaccharide	IC	16514062
GO:0033623	Process	Regulation of integrin activation	IMP	17632516
GO:0033691	Function	Sialic acid binding	IBA
GO:0033691	Function	Sialic acid binding	IDA	7680663
GO:0033691	Function	Sialic acid binding	IEA
GO:0034097	Process	Response to cytokine	IBA
GO:0042806	Function	Fucose binding	IDA	7680663
GO:0043208	Function	Glycosphingolipid binding	TAS	7680663
GO:0046872	Function	Metal ion binding	IEA
GO:0048306	Function	Calcium-dependent protein binding	IEA
GO:0050829	Process	Defense response to Gram-negative bacterium	IC	16514062
GO:0050900	Process	Leukocyte migration	IEA
GO:0050901	Process	Leukocyte tethering or rolling	IBA
GO:0050901	Process	Leukocyte tethering or rolling	IEA
GO:0050901	Process	Leukocyte tethering or rolling	IEA
GO:0050901	Process	Leukocyte tethering or rolling	IMP	28011641
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	17632516
GO:0070492	Function	Oligosaccharide binding	IBA
GO:0070492	Function	Oligosaccharide binding	IDA	7680663, 11081633, 28011641
GO:0070492	Function	Oligosaccharide binding	IEA
GO:0098609	Process	Cell-cell adhesion	IDA	37184585
GO:0098742	Process	Cell-cell adhesion via plasma-membrane adhesion molecules	IEA
GO:1903238	Process	Positive regulation of leukocyte tethering or rolling	IEA
GO:1903238	Process	Positive regulation of leukocyte tethering or rolling	ISS

MIM	HGNC	e!Ensembl
173610	10721	ENSG00000174175

P16109

Protein name

P-selectin (CD62 antigen-like family member P) (Granule membrane protein 140) (GMP-140) (Leukocyte-endothelial cell adhesion molecule 3) (LECAM3) (Platelet activation dependent granule-external membrane protein) (PADGEM) (CD antigen CD62P)

Protein function

Ca(2+)-dependent receptor for myeloid cells that binds to carbohydrates on neutrophils and monocytes. Mediates the interaction of activated endothelial cells or platelets with leukocytes. The ligand recognized is sialyl-Lewis X. Mediates rapid r

PDB

1FSB , 1G1Q , 1G1R , 1G1S , 1HES

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00059	Lectin_C	49 → 160	Lectin C-type domain	Domain
PF00084	Sushi	200 → 257	Sushi repeat (SCR repeat)	Domain
PF00084	Sushi	262 → 319	Sushi repeat (SCR repeat)	Domain
PF00084	Sushi	324 → 381	Sushi repeat (SCR repeat)	Domain
PF00084	Sushi	386 → 443	Sushi repeat (SCR repeat)	Domain
PF00084	Sushi	448 → 505	Sushi repeat (SCR repeat)	Domain
PF00084	Sushi	510 → 567	Sushi repeat (SCR repeat)	Domain
PF00084	Sushi	572 → 629	Sushi repeat (SCR repeat)	Domain
PF00084	Sushi	642 → 699	Sushi repeat (SCR repeat)	Domain
PF00084	Sushi	704 → 761	Sushi repeat (SCR repeat)	Domain

Tissue specificity

TISSUE SPECIFICITY: Stored in the alpha-granules of platelets and Weibel-Palade bodies of endothelial cells. Upon cell activation by agonists, P-selectin is transported rapidly to the cell surface.

Sequence

MANCQIAILYQRFQRVVFGISQLLCFSALISELTNQKEVAAWTYHYSTKAYSWNISRKYC
QNRYTDLVAIQNKNEIDYLNKVLPYYSSYYWIGIRKNNKTWTWVGTKKALTNEAENWADN
EPNNKRNNEDCVEIYIKSPSAPGKWNDEHCLKKKHALCYTASCQDMSCSKQGECLETIGN
YTCSCYPGFYGPECEYVRECGELELPQHVLMNCSHPLGNFSFNSQCSFHCTDGYQVNGPS
KLECLASGIWTNKPPQCLAAQCPPLKIPERGNMTCLHSAKAFQHQSSCSFSCEEGFALVG
PEVVQCTASGVWTAPAPVCKAVQCQHLEAPSEGTMDCVHPLTAFAYGSSCKFECQPGYRV
RGLDMLRCIDSGHWSAPLPTCEAISCEPLESPVHGSMDCSPSLRAFQYDTNCSFRCAEGF
MLRGADIVRCDNLGQWTAPAPVCQALQCQDLPVPNEARVNCSHPFGAFRYQSVCSFTCNE
GLLLVGASVLQCLATGNWNSVPPECQAIPCTPLLSPQNGTMTCVQPLGSSSYKSTCQFIC
DEGYSLSGPERLDCTRSGRWTDSPPMCEAIKCPELFAPEQGSLDCSDTRGEFNVGSTCHF
SCDNGFKLEGPNNVECTTSGRWSATPPTCKGIASLPTPGLQCPALTTPGQGTMYCRHHPG
TFGFNTTCYFGCNAGFTLIGDSTLSCRPSGQWTAVTPACRAVKCSELHVNKPIAMNCSNL
WGNFSYGSICSFHCLEGQLLNGSAQTACQENGHWSTTVPTCQAGPLTIQEALTYFGGAVA
STIGLIMGGTLLALLRKRFRQKDDGKCPLNPHSHLGTYGVFTNAAFDPSP

Sequence length

830

Interactions

View interactions

	KEGG		Reactome
	Cell adhesion molecules Neutrophil extracellular trap formation Malaria Staphylococcus aureus infection Coronavirus disease - COVID-19 Lipid and atherosclerosis		Platelet degranulation Cell surface interactions at the vascular wall

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Premature coronary artery atherosclerosis	Likely pathogenic	rs730880284	RCV000157648	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (19)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATRIAL FIBRILLATION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSED MOOD	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS, ATOPIC	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERSENSITIVITY	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LATE-ONSET ALZHEIMER'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY GRAFT DYSFUNCTION	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RECLASSIFIED - SELP POLYMORPHISM	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SELP POLYMORPHISM	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SELP-related disorder	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THROMBOSIS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

SELP (selectin P)