Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	6398
Gene name	Secreted and transmembrane 1
Gene symbol	SECTM1
Synonyms (NCBI Gene)	K12SECTM
Chromosome	17
Chromosome location	17q25.3
Summary	This gene encodes a transmembrane and secreted protein with characteristics of a type 1a transmembrane protein. It is found in a perinuclear Golgi-like pattern and thought to be involved in hematopoietic and/or immune system processes. [provided by RefSeq

Show/Hide all (35)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022533	hsa-miR-124-3p	Microarray	18668037
MIRT719387	hsa-miR-181d-3p	HITS-CLIP	19536157
MIRT719386	hsa-miR-6752-3p	HITS-CLIP	19536157
MIRT719385	hsa-miR-6499-5p	HITS-CLIP	19536157
MIRT719387	hsa-miR-181d-3p	HITS-CLIP	19536157
MIRT719386	hsa-miR-6752-3p	HITS-CLIP	19536157
MIRT719385	hsa-miR-6499-5p	HITS-CLIP	19536157
MIRT664654	hsa-miR-6746-3p	HITS-CLIP	23824327
MIRT664653	hsa-miR-615-3p	HITS-CLIP	23824327
MIRT664652	hsa-miR-1281	HITS-CLIP	23824327
MIRT664651	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT664650	hsa-miR-7977	HITS-CLIP	23824327
MIRT664652	hsa-miR-1281	PAR-CLIP	26701625
MIRT664653	hsa-miR-615-3p	PAR-CLIP	26701625
MIRT664654	hsa-miR-6746-3p	PAR-CLIP	26701625
MIRT664651	hsa-miR-6778-3p	PAR-CLIP	26701625
MIRT664650	hsa-miR-7977	PAR-CLIP	26701625
MIRT719387	hsa-miR-181d-3p	HITS-CLIP	19536157
MIRT719386	hsa-miR-6752-3p	HITS-CLIP	19536157
MIRT719385	hsa-miR-6499-5p	HITS-CLIP	19536157
MIRT719387	hsa-miR-181d-3p	HITS-CLIP	19536157
MIRT719386	hsa-miR-6752-3p	HITS-CLIP	19536157
MIRT719385	hsa-miR-6499-5p	HITS-CLIP	19536157
MIRT664654	hsa-miR-6746-3p	HITS-CLIP	23824327
MIRT664653	hsa-miR-615-3p	HITS-CLIP	23824327
MIRT664652	hsa-miR-1281	HITS-CLIP	23824327
MIRT664651	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT664650	hsa-miR-7977	HITS-CLIP	23824327
MIRT1333956	hsa-miR-3162-3p	CLIP-seq
MIRT1333957	hsa-miR-4508	CLIP-seq
MIRT1333958	hsa-miR-4532	CLIP-seq
MIRT2098801	hsa-miR-3141	CLIP-seq
MIRT2098801	hsa-miR-3141	CLIP-seq
MIRT2323548	hsa-miR-4651	CLIP-seq
MIRT2323549	hsa-miR-608	CLIP-seq

Show/Hide all (21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002726	Process	Positive regulation of T cell cytokine production	IDA	10652336
GO:0002726	Process	Positive regulation of T cell cytokine production	IDA	22184754
GO:0005125	Function	Cytokine activity	IEA
GO:0005125	Function	Cytokine activity	TAS	9480746
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	TAS	9480746
GO:0005794	Component	Golgi apparatus	TAS	9480746
GO:0005886	Component	Plasma membrane	IDA	10652336
GO:0005886	Component	Plasma membrane	IEA
GO:0006955	Process	Immune response	IEA
GO:0006955	Process	Immune response	TAS	9480746
GO:0007498	Process	Mesoderm development	TAS	9480746
GO:0016020	Component	Membrane	IBA
GO:0016020	Component	Membrane	IDA	9480746
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	9480746
GO:0038110	Process	Interleukin-2-mediated signaling pathway	IDA	22844114
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	HMP	12761501
GO:0048018	Function	Receptor ligand activity	IDA	10652336
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145

MIM	HGNC	e!Ensembl
602602	10707	ENSG00000141574

Q8WVN6

Protein name

Secreted and transmembrane protein 1 (Protein K-12)

Protein function

May be involved in thymocyte signaling.

Family and domains

Tissue specificity

TISSUE SPECIFICITY: Detected at the highest levels in peripheral blood leukocytes and breast cancer cell lines. Found in leukocytes of the myeloid lineage, with the strongest expression observed in granulocytes and no detectable expression in lymphocytes.

Sequence

MQTCPLAFPGHVSQALGTLLFLAASLSAQNEGWDSPICTEGVVSVSWGENTVMSCNISNA
FSHVNIKLRAHGQESAIFNEVAPGYFSRDGWQLQVQGGVAQLVIKGARDSHAGLYMWHLV
GHQRNNRQVTLEVSGAEPQSAPDTGFWPVPAVVTAVFILLVALVMFAWYRCRCSQQRREK
KFFLLEPQMKVAALRAGAQQGLSRASAELWTPDSEPTPRPLALVFKPSPLGALELLSPQP
LFPYAADP

Sequence length

248

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BENIGN THYROID GLAND NEOPLASM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (4)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	37455213	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Corneal Dystrophy, Juvenile Epithelial of Meesmann	Corneal Dystrophy, Epithelial Of Meesmann	BEFREE	10781519, 12084738, 9171831		★★★★★ ★☆☆☆☆ Found in Text Mining only
Macular dystrophy, corneal type 1	Macular corneal dystrophy	BEFREE	10781519		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	24157461	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

SECTM1 (secreted and transmembrane 1)