Gene Gene information from NCBI Gene database.
Entrez ID 63979
Gene name Fidgetin like 1
Gene symbol FIGNL1
Synonyms (NCBI Gene)
-
Chromosome 7
Chromosome location 7p12.2
Summary This gene encodes a member of the AAA ATPase family of proteins. The encoded protein is recruited to sites of DNA damage where it plays a role in DNA double-strand break repair via homologous recombination. This protein has also been shown to localize to
miRNA miRNA information provided by mirtarbase database.
55
miRTarBase ID miRNA Experiments Reference
MIRT028035 hsa-miR-93-5p Sequencing 20371350
MIRT573961 hsa-miR-6507-5p PAR-CLIP 20371350
MIRT573960 hsa-miR-4661-5p PAR-CLIP 20371350
MIRT573959 hsa-miR-4491 PAR-CLIP 20371350
MIRT573958 hsa-miR-4657 PAR-CLIP 20371350
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
36
GO ID Ontology Definition Evidence Reference
GO:0000166 Function Nucleotide binding IEA
GO:0000228 Component Nuclear chromosome IDA 23754376
GO:0000287 Function Magnesium ion binding ISS
GO:0001649 Process Osteoblast differentiation IEA
GO:0001649 Process Osteoblast differentiation ISS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
615383 13286 ENSG00000132436
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q6PIW4
Protein name Fidgetin-like protein 1 (EC 3.6.4.-)
Protein function Involved in DNA double-strand break (DBS) repair via homologous recombination (HR). Recruited at DSB sites independently of BRCA2, RAD51 and RAD51 paralogs in a H2AX-dependent manner. May regulate osteoblast proliferation and differentiation (Pu
PDB 3D8B , 8R64
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00004 AAA 437 567 ATPase family associated with various cellular activities (AAA) Domain
PF09336 Vps4_C 625 671 Vps4 C terminal oligomerisation domain Domain
Sequence
MQTSSSRSVHLSEWQKNYFAITSGICTGPKADAYRAQILRIQYAWANSEISQVCATKLFK
KYAEKYSAIIDSDNVESGLNNYAENILTLAGSQQTDSDKWQSGLSINNVFKMSSVQKMMQ
AGKKFKDSLLEPALASVVIHKEATVFDLPKFSVCGSSQESDSLPNSAHDRDRTQDFPESN
RLKLLQNAQPPMVTNTARTCPTFSAPVGESATAKFHVTPLFGNVKKENHSSAKENIGLNV
FLSNQSCFPAACENPQRKSFYGSGTIDALSNPILNKACSKTEDNGPKEDSSLPTFKTAKE
QLWVDQQKKYHQPQRASGSSYGGVKKSLGASRSRGILGKFVPPIPKQDGGEQNGGMQCKP
YGAGPTEPAHPVDERLKNLEPKMIELIMNEIMDHGPPVNWEDIAGVEFAKATIKEIVVWP
MLRPDIFTGLRGPPKGILLFGPPGTGKTLIGKCIASQSGATFFSISASSLTSKWVGEGEK
MVRALFAVARCQQPAVIFIDEIDSLLSQRGDGEHESSRRIKTEFLVQLDGATTSSEDRIL
VVGATNRPQEIDEAARRRLVKRLYIPL
PEASARKQIVINLMSKEQCCLSEEEIEQIVQQS
DAFSGADMTQLCREASLGPIRSLQTADIATITPDQVRPIAYIDFENAFRTVRPSVSPKDL
ELYENWNKTFG
CGK
Sequence length 674
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
KIDNEY NEOPLASMS CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Deficiency of aromatic-L-amino-acid decarboxylase Deficiency Of Aromatic-L-Amino-Acid Decarboxylase CLINVAR_DG 15079002, 17240182, 20505134
★☆☆☆☆
Found in Text Mining only
Dysarthria Dysarthria CLINVAR_DG
★☆☆☆☆
Found in Text Mining only
Kidney Neoplasm Kidney Neoplasm CTD_human_DG 28321044
★☆☆☆☆
Found in Text Mining only
Macular Degeneration Macular degeneration Pubtator 29696386 Stimulate
★☆☆☆☆
Found in Text Mining only
Malignant neoplasm of kidney Kidney Cancer CTD_human_DG 28321044
★☆☆☆☆
Found in Text Mining only
Moderate intellectual disability Mental retardation CLINVAR_DG
★☆☆☆☆
Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma Lymphoblastic Leukemia GWASDB_DG 19684603, 23512250
★☆☆☆☆
Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma Lymphoblastic Leukemia GWASCAT_DG 22076464
★☆☆☆☆
Found in Text Mining only
Small cell carcinoma of lung Lung carcinoma BEFREE 28260065
★☆☆☆☆
Found in Text Mining only
Small Cell Lung Carcinoma Small cell lung carcinoma Pubtator 28260065 Stimulate
★☆☆☆☆
Found in Text Mining only