Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	6397
Gene name	SEC14 like lipid binding 1
Gene symbol	SEC14L1
Synonyms (NCBI Gene)	PRELID4ASEC14L
Chromosome	17
Chromosome location	17q25.2-q25.3
Summary	The protein encoded by this gene belongs to the SEC14 cytosolic factor family. It has similarity to yeast SEC14 and to Japanese flying squid RALBP which suggests a possible role of the gene product in an intracellular transport system. Multiple alternativ

203

Show/Hide all (203)

miRTarBase ID	miRNA	Experiments	Reference
MIRT049000	hsa-miR-92a-3p	CLASH	23622248
MIRT044467	hsa-miR-320a	CLASH	23622248
MIRT037755	hsa-miR-708-5p	CLASH	23622248
MIRT036159	hsa-miR-320c	CLASH	23622248
MIRT638302	hsa-let-7c-3p	HITS-CLIP	23824327
MIRT638302	hsa-let-7c-3p	HITS-CLIP	23824327
MIRT1332194	hsa-let-7a	CLIP-seq
MIRT1332195	hsa-let-7b	CLIP-seq
MIRT1332196	hsa-let-7c	CLIP-seq
MIRT1332197	hsa-let-7d	CLIP-seq
MIRT1332198	hsa-let-7e	CLIP-seq
MIRT1332199	hsa-let-7f	CLIP-seq
MIRT1332200	hsa-let-7g	CLIP-seq
MIRT1332201	hsa-let-7i	CLIP-seq
MIRT1332202	hsa-miR-1294	CLIP-seq
MIRT1332203	hsa-miR-202	CLIP-seq
MIRT1332204	hsa-miR-4307	CLIP-seq
MIRT1332205	hsa-miR-4458	CLIP-seq
MIRT1332206	hsa-miR-4500	CLIP-seq
MIRT1332207	hsa-miR-4517	CLIP-seq
MIRT1332208	hsa-miR-556-3p	CLIP-seq
MIRT1332209	hsa-miR-98	CLIP-seq
MIRT1332210	hsa-miR-1263	CLIP-seq
MIRT1332211	hsa-miR-4251	CLIP-seq
MIRT1332212	hsa-miR-4329	CLIP-seq
MIRT1332213	hsa-miR-4786-5p	CLIP-seq
MIRT1332214	hsa-miR-500a	CLIP-seq
MIRT1332215	hsa-miR-501-5p	CLIP-seq
MIRT1332216	hsa-miR-606	CLIP-seq
MIRT1332217	hsa-miR-769-5p	CLIP-seq
MIRT1332194	hsa-let-7a	CLIP-seq
MIRT1332195	hsa-let-7b	CLIP-seq
MIRT1332196	hsa-let-7c	CLIP-seq
MIRT1332197	hsa-let-7d	CLIP-seq
MIRT1332198	hsa-let-7e	CLIP-seq
MIRT1332199	hsa-let-7f	CLIP-seq
MIRT1332200	hsa-let-7g	CLIP-seq
MIRT1332201	hsa-let-7i	CLIP-seq
MIRT1332218	hsa-miR-1252	CLIP-seq
MIRT1332202	hsa-miR-1294	CLIP-seq
MIRT1332203	hsa-miR-202	CLIP-seq
MIRT1332219	hsa-miR-208a	CLIP-seq
MIRT1332220	hsa-miR-208b	CLIP-seq
MIRT1332221	hsa-miR-31	CLIP-seq
MIRT1332222	hsa-miR-3609	CLIP-seq
MIRT1332223	hsa-miR-3617	CLIP-seq
MIRT1332224	hsa-miR-3688-5p	CLIP-seq
MIRT1332204	hsa-miR-4307	CLIP-seq
MIRT1332205	hsa-miR-4458	CLIP-seq
MIRT1332225	hsa-miR-4476	CLIP-seq
MIRT1332206	hsa-miR-4500	CLIP-seq
MIRT1332207	hsa-miR-4517	CLIP-seq
MIRT1332226	hsa-miR-4533	CLIP-seq
MIRT1332227	hsa-miR-499-5p	CLIP-seq
MIRT1332228	hsa-miR-503	CLIP-seq
MIRT1332229	hsa-miR-520d-5p	CLIP-seq
MIRT1332230	hsa-miR-524-5p	CLIP-seq
MIRT1332231	hsa-miR-548ah	CLIP-seq
MIRT1332232	hsa-miR-548c-3p	CLIP-seq
MIRT1332233	hsa-miR-548u	CLIP-seq
MIRT1332208	hsa-miR-556-3p	CLIP-seq
MIRT1332234	hsa-miR-641	CLIP-seq
MIRT1332235	hsa-miR-651	CLIP-seq
MIRT1332209	hsa-miR-98	CLIP-seq
MIRT1332236	hsa-miR-1271	CLIP-seq
MIRT1332237	hsa-miR-182	CLIP-seq
MIRT1332238	hsa-miR-3170	CLIP-seq
MIRT1332239	hsa-miR-3622b-5p	CLIP-seq
MIRT1332240	hsa-miR-3675-3p	CLIP-seq
MIRT1332241	hsa-miR-4642	CLIP-seq
MIRT1332242	hsa-miR-4643	CLIP-seq
MIRT1332243	hsa-miR-96	CLIP-seq
MIRT2618858	hsa-miR-1180	CLIP-seq
MIRT2618859	hsa-miR-1205	CLIP-seq
MIRT2618860	hsa-miR-1207-5p	CLIP-seq
MIRT2618861	hsa-miR-1233	CLIP-seq
MIRT1332236	hsa-miR-1271	CLIP-seq
MIRT2618862	hsa-miR-1286	CLIP-seq
MIRT2618863	hsa-miR-1290	CLIP-seq
MIRT2618864	hsa-miR-129-3p	CLIP-seq
MIRT2618865	hsa-miR-135a	CLIP-seq
MIRT2618866	hsa-miR-135b	CLIP-seq
MIRT2618867	hsa-miR-136	CLIP-seq
MIRT2618868	hsa-miR-139-3p	CLIP-seq
MIRT2618869	hsa-miR-1470	CLIP-seq
MIRT1332237	hsa-miR-182	CLIP-seq
MIRT2618870	hsa-miR-1909	CLIP-seq
MIRT2618871	hsa-miR-2113	CLIP-seq
MIRT2618872	hsa-miR-2277-3p	CLIP-seq
MIRT2618873	hsa-miR-300	CLIP-seq
MIRT1332221	hsa-miR-31	CLIP-seq
MIRT2618874	hsa-miR-3133	CLIP-seq
MIRT2618875	hsa-miR-3157-5p	CLIP-seq
MIRT2618876	hsa-miR-3162-3p	CLIP-seq
MIRT2618877	hsa-miR-3167	CLIP-seq
MIRT2618878	hsa-miR-3168	CLIP-seq
MIRT1332238	hsa-miR-3170	CLIP-seq
MIRT2618879	hsa-miR-3177-3p	CLIP-seq
MIRT2618880	hsa-miR-3192	CLIP-seq
MIRT2618881	hsa-miR-335	CLIP-seq
MIRT1332239	hsa-miR-3622b-5p	CLIP-seq
MIRT2618882	hsa-miR-3689a-3p	CLIP-seq
MIRT2618883	hsa-miR-3689c	CLIP-seq
MIRT2618884	hsa-miR-381	CLIP-seq
MIRT2618885	hsa-miR-423-3p	CLIP-seq
MIRT2618886	hsa-miR-4277	CLIP-seq
MIRT2618887	hsa-miR-4286	CLIP-seq
MIRT2618888	hsa-miR-4290	CLIP-seq
MIRT2618889	hsa-miR-4315	CLIP-seq
MIRT2618890	hsa-miR-4418	CLIP-seq
MIRT2618891	hsa-miR-4436a	CLIP-seq
MIRT2618892	hsa-miR-4446-3p	CLIP-seq
MIRT2618893	hsa-miR-4461	CLIP-seq
MIRT2618894	hsa-miR-4637	CLIP-seq
MIRT1332241	hsa-miR-4642	CLIP-seq
MIRT2618895	hsa-miR-4661-5p	CLIP-seq
MIRT2618896	hsa-miR-4664-3p	CLIP-seq
MIRT2618897	hsa-miR-4666-3p	CLIP-seq
MIRT2618898	hsa-miR-4667-3p	CLIP-seq
MIRT2618899	hsa-miR-4687-5p	CLIP-seq
MIRT2618900	hsa-miR-4707-5p	CLIP-seq
MIRT2618901	hsa-miR-4721	CLIP-seq
MIRT2618902	hsa-miR-4722-5p	CLIP-seq
MIRT2618903	hsa-miR-4728-5p	CLIP-seq
MIRT2618904	hsa-miR-4746-5p	CLIP-seq
MIRT2618905	hsa-miR-4758-3p	CLIP-seq
MIRT2618906	hsa-miR-4763-3p	CLIP-seq
MIRT2618907	hsa-miR-4773	CLIP-seq
MIRT2618908	hsa-miR-486-3p	CLIP-seq
MIRT2618909	hsa-miR-498	CLIP-seq
MIRT2618910	hsa-miR-509-3-5p	CLIP-seq
MIRT2618911	hsa-miR-509-5p	CLIP-seq
MIRT2618912	hsa-miR-604	CLIP-seq
MIRT1332216	hsa-miR-606	CLIP-seq
MIRT2618913	hsa-miR-634	CLIP-seq
MIRT2618914	hsa-miR-647	CLIP-seq
MIRT2618915	hsa-miR-661	CLIP-seq
MIRT2618916	hsa-miR-876-5p	CLIP-seq
MIRT1332243	hsa-miR-96	CLIP-seq
MIRT2618859	hsa-miR-1205	CLIP-seq
MIRT2618860	hsa-miR-1207-5p	CLIP-seq
MIRT2618861	hsa-miR-1233	CLIP-seq
MIRT1332236	hsa-miR-1271	CLIP-seq
MIRT2618862	hsa-miR-1286	CLIP-seq
MIRT2618863	hsa-miR-1290	CLIP-seq
MIRT2618864	hsa-miR-129-3p	CLIP-seq
MIRT2618865	hsa-miR-135a	CLIP-seq
MIRT2618866	hsa-miR-135b	CLIP-seq
MIRT2618867	hsa-miR-136	CLIP-seq
MIRT2618868	hsa-miR-139-3p	CLIP-seq
MIRT2618869	hsa-miR-1470	CLIP-seq
MIRT1332237	hsa-miR-182	CLIP-seq
MIRT2618870	hsa-miR-1909	CLIP-seq
MIRT2618871	hsa-miR-2113	CLIP-seq
MIRT2618872	hsa-miR-2277-3p	CLIP-seq
MIRT2618873	hsa-miR-300	CLIP-seq
MIRT1332221	hsa-miR-31	CLIP-seq
MIRT2618874	hsa-miR-3133	CLIP-seq
MIRT2618875	hsa-miR-3157-5p	CLIP-seq
MIRT2618876	hsa-miR-3162-3p	CLIP-seq
MIRT2618877	hsa-miR-3167	CLIP-seq
MIRT1332238	hsa-miR-3170	CLIP-seq
MIRT2618880	hsa-miR-3192	CLIP-seq
MIRT2618881	hsa-miR-335	CLIP-seq
MIRT1332239	hsa-miR-3622b-5p	CLIP-seq
MIRT2618882	hsa-miR-3689a-3p	CLIP-seq
MIRT2618883	hsa-miR-3689c	CLIP-seq
MIRT2618884	hsa-miR-381	CLIP-seq
MIRT2618885	hsa-miR-423-3p	CLIP-seq
MIRT2618887	hsa-miR-4286	CLIP-seq
MIRT2618888	hsa-miR-4290	CLIP-seq
MIRT2618890	hsa-miR-4418	CLIP-seq
MIRT2690313	hsa-miR-4424	CLIP-seq
MIRT2618891	hsa-miR-4436a	CLIP-seq
MIRT2618892	hsa-miR-4446-3p	CLIP-seq
MIRT2618893	hsa-miR-4461	CLIP-seq
MIRT2618894	hsa-miR-4637	CLIP-seq
MIRT1332241	hsa-miR-4642	CLIP-seq
MIRT2618895	hsa-miR-4661-5p	CLIP-seq
MIRT2618897	hsa-miR-4666-3p	CLIP-seq
MIRT2618898	hsa-miR-4667-3p	CLIP-seq
MIRT2618899	hsa-miR-4687-5p	CLIP-seq
MIRT2618900	hsa-miR-4707-5p	CLIP-seq
MIRT2618901	hsa-miR-4721	CLIP-seq
MIRT2618902	hsa-miR-4722-5p	CLIP-seq
MIRT2618903	hsa-miR-4728-5p	CLIP-seq
MIRT2618904	hsa-miR-4746-5p	CLIP-seq
MIRT2690314	hsa-miR-4757-5p	CLIP-seq
MIRT2618905	hsa-miR-4758-3p	CLIP-seq
MIRT2618906	hsa-miR-4763-3p	CLIP-seq
MIRT2618907	hsa-miR-4773	CLIP-seq
MIRT2618908	hsa-miR-486-3p	CLIP-seq
MIRT2618909	hsa-miR-498	CLIP-seq
MIRT2618910	hsa-miR-509-3-5p	CLIP-seq
MIRT2618911	hsa-miR-509-5p	CLIP-seq
MIRT2618912	hsa-miR-604	CLIP-seq
MIRT1332216	hsa-miR-606	CLIP-seq
MIRT2618913	hsa-miR-634	CLIP-seq
MIRT2618914	hsa-miR-647	CLIP-seq
MIRT2618915	hsa-miR-661	CLIP-seq
MIRT2618916	hsa-miR-876-5p	CLIP-seq
MIRT1332243	hsa-miR-96	CLIP-seq
MIRT2618864	hsa-miR-129-3p	CLIP-seq

Show/Hide all (22)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002376	Process	Immune system process	IEA
GO:0002753	Process	Cytoplasmic pattern recognition receptor signaling pathway	IDA	16125763
GO:0005515	Function	Protein binding	IPI	17092608, 32296183
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IC	23843640
GO:0005737	Component	Cytoplasm	IDA	23843640
GO:0005737	Component	Cytoplasm	IDA	17092608
GO:0005737	Component	Cytoplasm	IEA
GO:0005794	Component	Golgi apparatus	IDA	17092608
GO:0005794	Component	Golgi apparatus	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA
GO:0009968	Process	Negative regulation of signal transduction	IEA
GO:0015871	Process	Choline transport	IDA	17092608
GO:0039532	Process	Negative regulation of cytoplasmic pattern recognition receptor signaling pathway	IDA	23843640
GO:0039536	Process	Negative regulation of RIG-I signaling pathway	IBA
GO:0039536	Process	Negative regulation of RIG-I signaling pathway	IMP	23843640
GO:0039552	Function	RIG-I binding	IBA
GO:0039552	Function	RIG-I binding	IPI	23843640
GO:0045087	Process	Innate immune response	IEA
GO:0140311	Function	Protein sequestering activity	IDA	23843640

MIM	HGNC	e!Ensembl
601504	10698	ENSG00000129657

Q92503

Protein name

SEC14-like protein 1

Protein function

May play a role in innate immunity by inhibiting the antiviral RIG-I signaling pathway. In this pathway, functions as a negative regulator of RIGI, the cytoplasmic sensor of viral nucleic acids. Prevents the interaction of RIGI with MAVS/IPS1, a

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF04707	PRELI	17 → 173	PRELI-like family	Family
PF03765	CRAL_TRIO_N	251 → 299	CRAL/TRIO, N-terminal domain	Domain
PF00650	CRAL_TRIO	321 → 490	CRAL/TRIO domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:8697811}.

Sequence

MVQKYQSPVRVYKYPFELIMAAYERRFPTCPLIPMFVGSDTVNEFKSEDGAIHVIERRCK
LDVDAPRLLKKIAGVDYVYFVQKNSLNSRERTLHIEAYNETFSNRVIINEHCCYTVHPEN
EDWTCFEQSASLDIKSFFGFESTVEKIAMKQYTSNIKKGKEIIEYYLRQLEEEGITFVPR
WSPPSITTSSETSSSSSKKQAASMAVVIPEAALKEGLSGDALSSPSAPEPVVGTPDDKLD
ADYIKRYLGDLTPLQESCLIRLRQWLQETHKGKIPKDEHILRFLRARDFNIDKAREIMCQ
SLTWRKQHQVDYILETWTPPQVLQDYYAGGWHHHDKDGRPLYVLRLGQMDTKGLVRALGE
EALLRYVLSINEEGLRRCEENTKVFGRPISSWTCLVDLEGLNMRHLWRPGVKALLRIIEV
VEANYPETLGRLLILRAPRVFPVLWTLVSPFIDDNTRRKFLIYAGNDYQGPGGLLDYIDK
EIIPDFLSGECMCEVPEGGLVPKSLYRTAEELENEDLKLWTETIYQSASVFKGAPHEILI
QIVDASSVITWDFDVCKGDIVFNIYHSKRSPQPPKKDSLGAHSITSPGGNNVQLIDKVWQ
LGRDYSMVESPLICKEGESVQGSHVTRWPGFYILQWKFHSMPACAASSLPRVDDVLASLQ
VSSHKCKVMYYTEVIGSEDFRGSMTSLESSHSGFSQLSAATTSSSQSHSSSMISR

Sequence length

715

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (6)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Clear cell carcinoma of kidney	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Monoclonal B-Cell Lymphocytosis	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (13)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Breast Carcinoma	Breast Carcinoma	BEFREE	29955149		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	29955149	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	11707779	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	29955149	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	29955149		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	23083832, 25701228		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	25701228		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11707779, 25701228		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	11707779		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	11707779	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	23083832		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis Pigmentosa	BEFREE	11707779		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis pigmentosa	Pubtator	11707779	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

SEC14L1 (SEC14 like lipid binding 1)