GPSM3 (G protein signaling modulator 3)

Gene

• Entrez ID: 63940
• Gene name: G protein signaling modulator 3
• Gene symbol: GPSM3
• Synonyms (NCBI Gene): AGS4, C6orf9, G18, G18.1a, G18.1b, G18.2, NG1
• Chromosome: 6
• Chromosome location: 6p21.32

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT2006262	hsa-miR-512-5p	CLIP-seq
MIRT2450670	hsa-miR-125a-3p	CLIP-seq
MIRT2450671	hsa-miR-1266	CLIP-seq
MIRT2450672	hsa-miR-3150a-5p	CLIP-seq
MIRT2450673	hsa-miR-3150b-5p	CLIP-seq
MIRT2450674	hsa-miR-3612	CLIP-seq
MIRT2450675	hsa-miR-3664-3p	CLIP-seq
MIRT2450676	hsa-miR-3934	CLIP-seq
MIRT2450677	hsa-miR-4443	CLIP-seq
MIRT2450678	hsa-miR-4518	CLIP-seq
MIRT2450679	hsa-miR-650	CLIP-seq
MIRT2450680	hsa-miR-764	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002690	Process	Positive regulation of leukocyte chemotaxis	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 32296183, 32814053, 33961781
GO:0005737	Component	Cytoplasm	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0030695	Function	GTPase regulator activity	IEA
GO:0050727	Process	Regulation of inflammatory response	IEA
GO:0050729	Process	Positive regulation of inflammatory response	IBA
GO:0050729	Process	Positive regulation of inflammatory response	IEA
GO:1900017	Process	Positive regulation of cytokine production involved in inflammatory response	IEA

Other IDs

• MIM: 618558
• HGNC: 13945
• e!Ensembl: ENSG00000213654

Protein

• UniProt ID: Q9Y4H4
• Protein name: G-protein-signaling modulator 3 (Activator of G-protein signaling 4) (G18.1b) (Protein G18)
• Protein function: Interacts with subunit of G(i) alpha proteins and regulates the activation of G(i) alpha proteins.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02188	GoLoco	63 → 84	GoLoco motif	Motif
  PF02188	GoLoco	133 → 155	GoLoco motif	Motif

• Tissue specificity: TISSUE SPECIFICITY: Expressed in heart, placenta, lung and liver. {ECO:0000269|PubMed:15096500}.
• Sequence:

  MEAERPQEEEDGEQGPPQDEEGWPPPNSTTRPWRSAPPSPPPPGTRHTALGPRSASLLSL
  QTELLLDLVAEAQSRRLEEQRATFYTPQNPSSLAPAPLRPLEDREQLYSTILSHQCQRME
  AQRSEPPLPPGGQELLELLLRVQGGGRMEEQRSRPPTHTC

• Sequence length: 160

Pathways

KEGG:

NOD-like receptor signaling pathway

Reactome:

G alpha (i) signalling events

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ATOPIC ECZEMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SARCOIDOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	27307211		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	26821282, 27307211		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	26821282, 27307211	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	26821282, 27307211	Associate	★☆☆☆☆ Found in Text Mining only
beta Thalassemia	Beta thalassemia	Pubtator	14587045	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	GWASDB_DG	21971053		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	GWASDB_DG	17632545		★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	28062526		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	GWASDB_DG	24871463		★☆☆☆☆ Found in Text Mining only
Mevalonate Kinase Deficiency	Mevalonate kinase deficiency	Pubtator	29268706	Associate	★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	GWASDB_DG	23055271		★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	BEFREE	28062526		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	GWASDB_DG	17804836, 21156761		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	26821282		★★☆☆☆ Found in Text Mining + Unknown/Other Associations