Gene Gene information from NCBI Gene database.
Entrez ID 63928
Gene name Calcineurin like EF-hand protein 2
Gene symbol CHP2
Synonyms (NCBI Gene)
-
Chromosome 16
Chromosome location 16p12.2
Summary This gene product is a small calcium-binding protein that regulates cell pH by controlling plasma membrane-type Na+/H+ exchange activity. This protein shares sequence similarity with calcineurin B and can bind to and stimulate the protein phosphatase acti
miRNA miRNA information provided by mirtarbase database.
117
miRTarBase ID miRNA Experiments Reference
MIRT891056 hsa-miR-106a CLIP-seq
MIRT891057 hsa-miR-106b CLIP-seq
MIRT891058 hsa-miR-1208 CLIP-seq
MIRT891059 hsa-miR-1249 CLIP-seq
MIRT891060 hsa-miR-1266 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
26
GO ID Ontology Definition Evidence Reference
GO:0005509 Function Calcium ion binding IBA
GO:0005509 Function Calcium ion binding IDA 21392185
GO:0005509 Function Calcium ion binding IEA
GO:0005515 Function Protein binding IPI 16710297, 21392185, 31912575, 32296183, 33961781
GO:0005634 Component Nucleus IDA 21392185
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O43745
Protein name Calcineurin B homologous protein 2 (Hepatocellular carcinoma-associated antigen 520)
Protein function Functions as an integral cofactor in cell pH regulation by controlling plasma membrane-type Na(+)/H(+) exchange activity. Binds to and activates SLC9A1/NHE1 in a serum-independent manner, thus increasing pH and protecting cells from serum depriv
PDB 2BEC
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13202 EF-hand_5 31 54 EF hand Domain
PF00036 EF-hand_1 115 143 EF hand Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in malignantly transformed cells but not detected in normal tissues. {ECO:0000269|PubMed:12097419, ECO:0000269|PubMed:12226101}.
Sequence
MGSRSSHAAVIPDGDSIRRETGFSQASLLRLHHRFRALDRNKKGYLSRMDLQQIGALAVN
PLGDRIIESFFPDGSQRVDFPGFVRVLAHFRPVEDEDTETQDPKKPEPLNSRRNKLHYAF
QLYDLDRDGKISRHEMLQVLRLM
VGVQVTEEQLENIADRTVQEADEDGDGAVSFVEFTKS
LEKMDVEQKMSIRILK
Sequence length 196
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
LYMPHEDEMA GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Breast Carcinoma Breast Carcinoma BEFREE 29967111
★☆☆☆☆
Found in Text Mining only
Carcinoma, Ovarian Epithelial Ovarian Epithelial carcinoma BEFREE 17708351
★☆☆☆☆
Found in Text Mining only
Epithelial ovarian cancer Ovarian cancer BEFREE 17708351
★☆☆☆☆
Found in Text Mining only
Malignant neoplasm of breast Breast Cancer BEFREE 29967111
★☆☆☆☆
Found in Text Mining only
Malignant neoplasm of ovary Ovarian cancer BEFREE 17708351
★☆☆☆☆
Found in Text Mining only
Malignant Neoplasms Malignant Neoplasm BEFREE 12097419
★☆☆☆☆
Found in Text Mining only
Neoplasms Neoplasms BEFREE 17708351, 26376646
★☆☆☆☆
Found in Text Mining only
ovarian neoplasm Ovarian neoplasm BEFREE 17708351
★☆☆☆☆
Found in Text Mining only
ovarian neoplasm Ovarian neoplasm LHGDN 17708351
★☆☆☆☆
Found in Text Mining only