TNN (tenascin N)

Gene

• Entrez ID: 63923
• Gene name: Tenascin N
• Gene symbol: TNN
• Synonyms (NCBI Gene): TN-W, TNW
• Chromosome: 1
• Chromosome location: 1q25.1

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1444007	hsa-miR-1207-3p	CLIP-seq
MIRT1444008	hsa-miR-127-5p	CLIP-seq
MIRT1444009	hsa-miR-138	CLIP-seq
MIRT1444010	hsa-miR-22	CLIP-seq
MIRT1444011	hsa-miR-221	CLIP-seq
MIRT1444012	hsa-miR-222	CLIP-seq
MIRT1444013	hsa-miR-3064-3p	CLIP-seq
MIRT1444014	hsa-miR-323-5p	CLIP-seq
MIRT1444015	hsa-miR-3609	CLIP-seq
MIRT1444016	hsa-miR-375	CLIP-seq
MIRT1444017	hsa-miR-4273	CLIP-seq
MIRT1444018	hsa-miR-4453	CLIP-seq
MIRT1444019	hsa-miR-4456	CLIP-seq
MIRT1444020	hsa-miR-4538	CLIP-seq
MIRT1444021	hsa-miR-4677-5p	CLIP-seq
MIRT1444022	hsa-miR-4734	CLIP-seq
MIRT1444023	hsa-miR-4767	CLIP-seq
MIRT1444024	hsa-miR-520g	CLIP-seq
MIRT1444025	hsa-miR-520h	CLIP-seq
MIRT1444026	hsa-miR-548ah	CLIP-seq
MIRT1444027	hsa-miR-548v	CLIP-seq
MIRT1444028	hsa-miR-876-3p	CLIP-seq
MIRT1444019	hsa-miR-4456	CLIP-seq
MIRT2132917	hsa-miR-4649-3p	CLIP-seq
MIRT2132918	hsa-miR-583	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005178	Function	Integrin binding	IBA
GO:0005178	Function	Integrin binding	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0007160	Process	Cell-matrix adhesion	IBA
GO:0007160	Process	Cell-matrix adhesion	IEA
GO:0007409	Process	Axonogenesis	IEA
GO:0009986	Component	Cell surface	IEA
GO:0010976	Process	Positive regulation of neuron projection development	IEA
GO:0010976	Process	Positive regulation of neuron projection development	ISO
GO:0030155	Process	Regulation of cell adhesion	IDA	17909022
GO:0030155	Process	Regulation of cell adhesion	IEA
GO:0030334	Process	Regulation of cell migration	IDA	17909022
GO:0030334	Process	Regulation of cell migration	IEA
GO:0031012	Component	Extracellular matrix	IBA
GO:0031012	Component	Extracellular matrix	IEA
GO:0042802	Function	Identical protein binding	IEA
GO:0043005	Component	Neuron projection	IEA
GO:0043025	Component	Neuronal cell body	IEA
GO:0070593	Process	Dendrite self-avoidance	ISA	12812753
GO:0090733	Component	Tenascin complex	IEA
GO:0090733	Component	Tenascin complex	IPI	17909022
GO:0097442	Component	CA3 pyramidal cell dendrite	IEA
GO:1903010	Process	Regulation of bone development	IEA
GO:1903010	Process	Regulation of bone development	ISO
GO:1903672	Process	Positive regulation of sprouting angiogenesis	IDA	19884327
GO:1905899	Process	Regulation of smooth muscle tissue development	IEA
GO:1905899	Process	Regulation of smooth muscle tissue development	ISO
GO:1990026	Component	Hippocampal mossy fiber expansion	IEA
GO:1990138	Process	Neuron projection extension	IBA
GO:2000026	Process	Regulation of multicellular organismal development	IEA
GO:2001223	Process	Negative regulation of neuron migration	ISA	12812753

Other IDs

• MIM: 617472
• HGNC: 22942
• e!Ensembl: ENSG00000120332

Protein

• UniProt ID: Q9UQP3
• Protein name: Tenascin-N (TN-N) (Tenascin-W) (TN-W)
• Protein function: Extracellular matrix protein that seems to be a ligand for ITGA8:ITGB1, ITGAV:ITGB1 and ITGA4:ITGB1 (By similarity) (PubMed:17909022). Involved in neurite outgrowth and cell migration in hippocampal explants (By similarity). During endochondral
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF18720	EGF_Tenascin	170 → 198	Tenascin EGF domain	Domain
  PF00041	fn3	263 → 343	Fibronectin type III domain	Domain
  PF00041	fn3	356 → 434	Fibronectin type III domain	Domain
  PF00041	fn3	444 → 522	Fibronectin type III domain	Domain
  PF00041	fn3	532 → 611	Fibronectin type III domain	Domain
  PF00041	fn3	621 → 699	Fibronectin type III domain	Domain
  PF00041	fn3	709 → 788	Fibronectin type III domain	Domain
  PF00041	fn3	798 → 876	Fibronectin type III domain	Domain
  PF00041	fn3	886 → 964	Fibronectin type III domain	Domain
  PF00041	fn3	974 → 1051	Fibronectin type III domain	Domain
  PF00147	Fibrinogen_C	1066 → 1277	Fibrinogen beta and gamma chains, C-terminal globular domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Not detected in normal adult mammary tissues or brain but expressed in most breast tumors and brain tumors, such as glioblastomas, astrocytomas and oligodendrogliomas, tested (PubMed:17909022, PubMed:19884327). In brain tumors, detecte
• Sequence:

  MSLQEMFRFPMGLLLGSVLLVASAPATLEPPGCSNKEQQVTVSHTYKIDVPKSALVQVDA
  DPQPLSDDGASLLALGEAREEQNIIFRHNIRLQTPQKDCELAGSVQDLLARVKKLEEEMV
  EMKEQCSAQRCCQGVTDLSRHCSGHGTFSLETCSCHCEEGREGPACERLACPGACSGHGR
  CVDGRCLCHEPYVGADCGYPACPENCSGHGECVRGVCQCHEDFMSEDCSEKRCPGDCSGH
  GFCDTGECYCEEGFTGLDCAQVVTPQGLQLLKNTEDSLLVSWEPSSQVDHYLLSYYPLGK
  ELSGKQIQVPKEQHSYEILGLLPGTKYIVTLRNVKNEVSSSPQHLLATTDLAVLGTAWVT
  DETENSLDVEWENPSTEVDYYKLRYGPMTGQEVAEVTVPKSSDPKSRYDITGLHPGTEYK
  ITVVPMRGELEGKPILLNGRTEIDSPTNVVTDRVTEDTATVSWDPVQAVIDKYVVRYTSA
  DGDTKEMAVHKDESSTVLTGLKPGEAYKVYVWAERGNQGSKKADTNALTEIDSPANLVTD
  RVTENTATISWDPVQATIDKYVVRYTSADDQETREVLVGKEQSSTVLTGLRPGVEYTVHV
  WAQKGDRESKKADTNAPTDIDSPKNLVTDRVTENMATVSWDPVQAAIDKYVVRYTSAGGE
  TREVPVGKEQSSTVLTGLRPGMEYMVHVWAQKGDQESKKADTKAQTDIDSPQNLVTDRVT
  ENMATVSWDPVRATIDRYVVRYTSAKDGETREVPVGKEQSSTVLTGLRPGVEYTVHVWAQ
  KGAQESKKADTKAQTDIDSPQNLVTDWVTENTATVSWDPVQATIDRYVVHYTSANGETRE
  VPVGKEQSSTVLTGLRPGMEYTVHVWAQKGNQESKKADTKAQTEIDGPKNLVTDWVTENM
  ATVSWDPVQATIDKYMVRYTSADGETREVPVGKEHSSTVLTGLRPGMEYMVHVWAQKGAQ
  ESKKADTKAQTELDPPRNLRPSAVTQSGGILTWTPPSAQIHGYILTYQFPDGTVKEMQLG
  REDQRFALQGLEQGATYPVSLVAFKGGRRSRNVSTTLSTVGARFPHPSDCSQVQQNSNAA
  SGLYTIYLHGDASRPLQVYCDMETDGGGWIVFQRRNTGQLDFFKRWRSYVEGFGDPMKEF
  WLGLDKLHNLTTGTPARYEVRVDLQTANESAYAIYDFFQVASSKERYKLTVGKYRGTAGD
  ALTYHNGWKFTTFDRDNDIALSNCALTHHGGWWYKNCHLANPNGRYGETKHSEGVNWEPW
  KGHEFSIPYVELKIRPHGYSREPVLGRKKRTLRGRLRTF

• Sequence length: 1299

Pathways

KEGG:

PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Human papillomavirus infection
MicroRNAs in cancer

Reactome:

ECM proteoglycans

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ATRIAL FIBRILLATION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of urinary bladder	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBSESSIVE-COMPULSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Breast Carcinoma	Breast Carcinoma	BEFREE	15592496, 17909022, 25868708		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	34408553	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	18306355		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	33714943	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	25868708		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	25868708		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	15592496, 17909022, 25868708		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15592496, 20541035, 21441591		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	17909022		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	17909022, 18306355		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15592496, 17909022, 21441591, 31032255		★☆☆☆☆ Found in Text Mining only