PRDM1 (PR/SET domain 1)

Gene

• Entrez ID: 639
• Gene name: PR/SET domain 1
• Gene symbol: PRDM1
• Synonyms (NCBI Gene): BLIMP-1, BLIMP1, PRDI-BF1
• Chromosome: 6
• Chromosome location: 6q21
• Summary: This gene encodes a protein that acts as a repressor of beta-interferon gene expression. The protein binds specifically to the PRDI (positive regulatory domain I element) of the beta-IFN gene promoter. Transcription of this gene increases upon virus induc

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT001937	hsa-miR-9-5p	Luciferase reporter assay	18583325
MIRT001937	hsa-miR-9-5p	Luciferase reporter assay	18583325
MIRT001937	hsa-miR-9-5p	Luciferase reporter assay	18583325
MIRT001936	hsa-let-7a-5p	Luciferase reporter assay	18583325
MIRT004279	hsa-miR-127-3p	qRT-PCR, Luciferase reporter assay, Western blot	19530237
MIRT001937	hsa-miR-9-5p	Luciferase reporter assay	18583325
MIRT001937	hsa-miR-9-5p	Luciferase reporter assay	18583325
MIRT001937	hsa-miR-9-5p	Luciferase reporter assay	18583325
MIRT001936	hsa-let-7a-5p	Luciferase reporter assay	18583325
MIRT001937	hsa-miR-9-5p	Luciferase reporter assay	19956200
MIRT001936	hsa-let-7a-5p	Luciferase reporter assay	18583325
MIRT001937	hsa-miR-9-5p	Luciferase reporter assay	18583325
MIRT004533	hsa-miR-125b-5p	qRT-PCR, Luciferase reporter assay	20497960
MIRT001936	hsa-let-7a-5p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	20651244
MIRT001936	hsa-let-7a-5p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	20651244
MIRT005513	hsa-let-7b-5p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	20651244
MIRT005513	hsa-let-7b-5p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	20651244
MIRT005514	hsa-let-7f-5p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	20651244
MIRT005514	hsa-let-7f-5p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	20651244
MIRT001937	hsa-miR-9-5p	ChIP-seq, FACS, Luciferase reporter assay, qRT-PCR	23129528
MIRT001937	hsa-miR-9-5p	ChIP-seq, FACS, Luciferase reporter assay, qRT-PCR	23129528
MIRT001937	hsa-miR-9-5p	ChIP-seq, FACS, Luciferase reporter assay, qRT-PCR	23129528
MIRT007218	hsa-miR-30a-5p	Luciferase reporter assay	23348703
MIRT037062	hsa-miR-877-3p	CLASH	23622248
MIRT054801	hsa-miR-223-3p	Luciferase reporter assay, qRT-PCR, Western blot	24438193
MIRT054801	hsa-miR-223-3p	Luciferase reporter assay, qRT-PCR, Western blot	24438193
MIRT054801	hsa-miR-223-3p	Luciferase reporter assay, qRT-PCR, Western blot	24438193
MIRT437582	hsa-miR-125a-5p	Microarray, qRT-PCR	22815788
MIRT437596	hsa-miR-140-5p	Microarray, qRT-PCR	22815788
MIRT054801	hsa-miR-223-3p	Microarray, qRT-PCR	22815788
MIRT005514	hsa-let-7f-5p	qRT-PCR	24405266
MIRT005514	hsa-let-7f-5p	qRT-PCR	24405266
MIRT005514	hsa-let-7f-5p	qRT-PCR	24405266
MIRT005514	hsa-let-7f-5p	qRT-PCR	24405266
MIRT610589	hsa-miR-938	HITS-CLIP	23824327
MIRT610588	hsa-miR-6886-3p	HITS-CLIP	23824327
MIRT610587	hsa-miR-3157-3p	HITS-CLIP	23824327
MIRT610586	hsa-miR-874-3p	HITS-CLIP	23824327
MIRT217240	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT610589	hsa-miR-938	HITS-CLIP	23824327
MIRT610588	hsa-miR-6886-3p	HITS-CLIP	23824327
MIRT610587	hsa-miR-3157-3p	HITS-CLIP	23824327
MIRT610586	hsa-miR-874-3p	HITS-CLIP	23824327
MIRT217240	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT610589	hsa-miR-938	HITS-CLIP	23824327
MIRT610588	hsa-miR-6886-3p	HITS-CLIP	23824327
MIRT610587	hsa-miR-3157-3p	HITS-CLIP	23824327
MIRT610586	hsa-miR-874-3p	HITS-CLIP	23824327
MIRT217240	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT610589	hsa-miR-938	HITS-CLIP	23824327
MIRT610588	hsa-miR-6886-3p	HITS-CLIP	23824327
MIRT610587	hsa-miR-3157-3p	HITS-CLIP	23824327
MIRT610586	hsa-miR-874-3p	HITS-CLIP	23824327
MIRT217240	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT610589	hsa-miR-938	HITS-CLIP	23824327
MIRT610588	hsa-miR-6886-3p	HITS-CLIP	23824327
MIRT610587	hsa-miR-3157-3p	HITS-CLIP	23824327
MIRT610586	hsa-miR-874-3p	HITS-CLIP	23824327
MIRT217240	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT610589	hsa-miR-938	HITS-CLIP	23824327
MIRT610588	hsa-miR-6886-3p	HITS-CLIP	23824327
MIRT610587	hsa-miR-3157-3p	HITS-CLIP	23824327
MIRT610586	hsa-miR-874-3p	HITS-CLIP	23824327
MIRT217240	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT610589	hsa-miR-938	HITS-CLIP	23824327
MIRT610588	hsa-miR-6886-3p	HITS-CLIP	23824327
MIRT610587	hsa-miR-3157-3p	HITS-CLIP	23824327
MIRT610586	hsa-miR-874-3p	HITS-CLIP	23824327
MIRT217240	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT610589	hsa-miR-938	HITS-CLIP	23824327
MIRT610588	hsa-miR-6886-3p	HITS-CLIP	23824327
MIRT610587	hsa-miR-3157-3p	HITS-CLIP	23824327
MIRT610586	hsa-miR-874-3p	HITS-CLIP	23824327
MIRT217240	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT217179	hsa-miR-374a-5p	HITS-CLIP	22473208
MIRT007218	hsa-miR-30a-5p	HITS-CLIP	22473208
MIRT167510	hsa-miR-30b-5p	HITS-CLIP	22473208
MIRT167508	hsa-miR-30c-5p	HITS-CLIP	22473208
MIRT167509	hsa-miR-30d-5p	HITS-CLIP	22473208
MIRT167511	hsa-miR-30e-5p	HITS-CLIP	22473208
MIRT217179	hsa-miR-374a-5p	HITS-CLIP	22473208
MIRT731781	hsa-miR-222-3p	Chromatin immunoprecipitation, Immunoblot, Luciferase reporter assay, Microarray, qRT-PCR	26655851
MIRT731781	hsa-miR-222-3p	Chromatin immunoprecipitation, Immunoblot, Luciferase reporter assay, Microarray, qRT-PCR	26655851
MIRT731781	hsa-miR-222-3p	Chromatin immunoprecipitation, Immunoblot, Luciferase reporter assay, Microarray, qRT-PCR	26655851
MIRT731781	hsa-miR-222-3p	Chromatin immunoprecipitation, Immunoblot, Luciferase reporter assay, Microarray, qRT-PCR	26655851
MIRT731781	hsa-miR-222-3p	Chromatin immunoprecipitation, Immunoblot, Luciferase reporter assay, Microarray, qRT-PCR	26655851
MIRT004533	hsa-miR-125b-5p	Chromatin immunoprecipitation, Immunoblot, Luciferase reporter assay, Microarray, qRT-PCR	26655851
MIRT731782	hsa-miR-101-3p	Chromatin immunoprecipitation, Immunoblot, Luciferase reporter assay, Microarray, qRT-PCR	26655851
MIRT731782	hsa-miR-101-3p	Chromatin immunoprecipitation, Immunoblot, Luciferase reporter assay, Microarray, qRT-PCR	26655851
MIRT731782	hsa-miR-101-3p	Chromatin immunoprecipitation, Immunoblot, Luciferase reporter assay, Microarray, qRT-PCR	26655851
MIRT731782	hsa-miR-101-3p	Chromatin immunoprecipitation, Immunoblot, Luciferase reporter assay, Microarray, qRT-PCR	26655851
MIRT004533	hsa-miR-125b-5p	Luciferase reporter assay, qRT-PCR, Western blot	27613090
MIRT217176	hsa-miR-125a-3p	Chromatin immunoprecipitation, Microarray, qRT-PCR, Western blot	28052011
MIRT007218	hsa-miR-30a-5p	qRT-PCR	26472042
MIRT217240	hsa-miR-129-5p	HITS-CLIP	27418678
MIRT610587	hsa-miR-3157-3p	HITS-CLIP	27418678
MIRT610588	hsa-miR-6886-3p	HITS-CLIP	27418678
MIRT610586	hsa-miR-874-3p	HITS-CLIP	27418678
MIRT610589	hsa-miR-938	HITS-CLIP	27418678
MIRT610589	hsa-miR-938	HITS-CLIP	23824327
MIRT610588	hsa-miR-6886-3p	HITS-CLIP	23824327
MIRT610587	hsa-miR-3157-3p	HITS-CLIP	23824327
MIRT610586	hsa-miR-874-3p	HITS-CLIP	23824327
MIRT217240	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT610589	hsa-miR-938	HITS-CLIP	23824327
MIRT610588	hsa-miR-6886-3p	HITS-CLIP	23824327
MIRT610587	hsa-miR-3157-3p	HITS-CLIP	23824327
MIRT610586	hsa-miR-874-3p	HITS-CLIP	23824327
MIRT217240	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT610589	hsa-miR-938	HITS-CLIP	23824327
MIRT610588	hsa-miR-6886-3p	HITS-CLIP	23824327
MIRT610587	hsa-miR-3157-3p	HITS-CLIP	23824327
MIRT610586	hsa-miR-874-3p	HITS-CLIP	23824327
MIRT217240	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT610589	hsa-miR-938	HITS-CLIP	23824327
MIRT610588	hsa-miR-6886-3p	HITS-CLIP	23824327
MIRT610587	hsa-miR-3157-3p	HITS-CLIP	23824327
MIRT610586	hsa-miR-874-3p	HITS-CLIP	23824327
MIRT217240	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT610589	hsa-miR-938	HITS-CLIP	23824327
MIRT610588	hsa-miR-6886-3p	HITS-CLIP	23824327
MIRT610587	hsa-miR-3157-3p	HITS-CLIP	23824327
MIRT610586	hsa-miR-874-3p	HITS-CLIP	23824327
MIRT217240	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT610589	hsa-miR-938	HITS-CLIP	23824327
MIRT610588	hsa-miR-6886-3p	HITS-CLIP	23824327
MIRT610587	hsa-miR-3157-3p	HITS-CLIP	23824327
MIRT610586	hsa-miR-874-3p	HITS-CLIP	23824327
MIRT217240	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT610589	hsa-miR-938	HITS-CLIP	23824327
MIRT610588	hsa-miR-6886-3p	HITS-CLIP	23824327
MIRT610587	hsa-miR-3157-3p	HITS-CLIP	23824327
MIRT610586	hsa-miR-874-3p	HITS-CLIP	23824327
MIRT217240	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT610589	hsa-miR-938	HITS-CLIP	23824327
MIRT610588	hsa-miR-6886-3p	HITS-CLIP	23824327
MIRT610587	hsa-miR-3157-3p	HITS-CLIP	23824327
MIRT610586	hsa-miR-874-3p	HITS-CLIP	23824327
MIRT217240	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT1259944	hsa-let-7a	CLIP-seq
MIRT1259945	hsa-let-7b	CLIP-seq
MIRT1259946	hsa-let-7c	CLIP-seq
MIRT1259947	hsa-let-7d	CLIP-seq
MIRT1259948	hsa-let-7e	CLIP-seq
MIRT1259949	hsa-let-7f	CLIP-seq
MIRT1259950	hsa-let-7g	CLIP-seq
MIRT1259951	hsa-let-7i	CLIP-seq
MIRT1259952	hsa-miR-106a	CLIP-seq
MIRT1259953	hsa-miR-106b	CLIP-seq
MIRT1259954	hsa-miR-1193	CLIP-seq
MIRT1259955	hsa-miR-142-5p	CLIP-seq
MIRT1259956	hsa-miR-17	CLIP-seq
MIRT1259957	hsa-miR-202	CLIP-seq
MIRT1259958	hsa-miR-20a	CLIP-seq
MIRT1259959	hsa-miR-20b	CLIP-seq
MIRT1259960	hsa-miR-2116	CLIP-seq
MIRT1259961	hsa-miR-2392	CLIP-seq
MIRT1259962	hsa-miR-2467-3p	CLIP-seq
MIRT1259963	hsa-miR-3134	CLIP-seq
MIRT1259964	hsa-miR-3153	CLIP-seq
MIRT1259965	hsa-miR-3609	CLIP-seq
MIRT1259966	hsa-miR-3613-3p	CLIP-seq
MIRT1259967	hsa-miR-365	CLIP-seq
MIRT1259968	hsa-miR-3654	CLIP-seq
MIRT1259969	hsa-miR-3678-3p	CLIP-seq
MIRT1259970	hsa-miR-3688-5p	CLIP-seq
MIRT1259971	hsa-miR-3924	CLIP-seq
MIRT1259972	hsa-miR-4311	CLIP-seq
MIRT1259973	hsa-miR-4428	CLIP-seq
MIRT1259974	hsa-miR-4458	CLIP-seq
MIRT1259975	hsa-miR-4470	CLIP-seq
MIRT1259976	hsa-miR-4487	CLIP-seq
MIRT1259977	hsa-miR-4500	CLIP-seq
MIRT1259978	hsa-miR-450b-5p	CLIP-seq
MIRT1259979	hsa-miR-4638-3p	CLIP-seq
MIRT1259980	hsa-miR-4668-5p	CLIP-seq
MIRT1259981	hsa-miR-4677-5p	CLIP-seq
MIRT1259982	hsa-miR-4710	CLIP-seq
MIRT1259983	hsa-miR-4719	CLIP-seq
MIRT1259984	hsa-miR-4792	CLIP-seq
MIRT1259985	hsa-miR-4796-3p	CLIP-seq
MIRT1259986	hsa-miR-519d	CLIP-seq
MIRT1259987	hsa-miR-548ah	CLIP-seq
MIRT1259988	hsa-miR-603	CLIP-seq
MIRT1259989	hsa-miR-653	CLIP-seq
MIRT1259990	hsa-miR-874	CLIP-seq
MIRT1259991	hsa-miR-93	CLIP-seq
MIRT1259992	hsa-miR-98	CLIP-seq
MIRT1259960	hsa-miR-2116	CLIP-seq
MIRT1259981	hsa-miR-4677-5p	CLIP-seq
MIRT1259993	hsa-miR-548n	CLIP-seq
MIRT1259990	hsa-miR-874	CLIP-seq
MIRT1259990	hsa-miR-874	CLIP-seq
MIRT1259960	hsa-miR-2116	CLIP-seq
MIRT1259981	hsa-miR-4677-5p	CLIP-seq
MIRT1259990	hsa-miR-874	CLIP-seq
MIRT2076573	hsa-miR-223	CLIP-seq
MIRT2076574	hsa-miR-4328	CLIP-seq
MIRT2076575	hsa-miR-4762-3p	CLIP-seq
MIRT2076576	hsa-miR-767-5p	CLIP-seq
MIRT1259983	hsa-miR-4719	CLIP-seq
MIRT1259990	hsa-miR-874	CLIP-seq
MIRT1259981	hsa-miR-4677-5p	CLIP-seq
MIRT2457097	hsa-miR-2117	CLIP-seq
MIRT2457098	hsa-miR-375	CLIP-seq
MIRT2457099	hsa-miR-4273	CLIP-seq
MIRT2457100	hsa-miR-4292	CLIP-seq
MIRT2457101	hsa-miR-4308	CLIP-seq
MIRT1259981	hsa-miR-4677-5p	CLIP-seq
MIRT2465901	hsa-miR-1236	CLIP-seq
MIRT2457097	hsa-miR-2117	CLIP-seq
MIRT2457098	hsa-miR-375	CLIP-seq
MIRT2457099	hsa-miR-4273	CLIP-seq
MIRT2457100	hsa-miR-4292	CLIP-seq
MIRT2457101	hsa-miR-4308	CLIP-seq
MIRT1259981	hsa-miR-4677-5p	CLIP-seq
MIRT2465902	hsa-miR-4753-3p	CLIP-seq
MIRT2465901	hsa-miR-1236	CLIP-seq
MIRT2599876	hsa-miR-1243	CLIP-seq
MIRT2599877	hsa-miR-1275	CLIP-seq
MIRT2599878	hsa-miR-1287	CLIP-seq
MIRT2457097	hsa-miR-2117	CLIP-seq
MIRT2076573	hsa-miR-223	CLIP-seq
MIRT2599879	hsa-miR-300	CLIP-seq
MIRT2599880	hsa-miR-3065-5p	CLIP-seq
MIRT2599881	hsa-miR-3074-5p	CLIP-seq
MIRT2599882	hsa-miR-30a	CLIP-seq
MIRT2599883	hsa-miR-30b	CLIP-seq
MIRT2599884	hsa-miR-30c	CLIP-seq
MIRT2599885	hsa-miR-30d	CLIP-seq
MIRT2599886	hsa-miR-30e	CLIP-seq
MIRT2599887	hsa-miR-3123	CLIP-seq
MIRT2599888	hsa-miR-3135b	CLIP-seq
MIRT2599889	hsa-miR-3143	CLIP-seq
MIRT2599890	hsa-miR-3148	CLIP-seq
MIRT2599891	hsa-miR-3617	CLIP-seq
MIRT2599892	hsa-miR-3620	CLIP-seq
MIRT2599893	hsa-miR-3652	CLIP-seq
MIRT1259968	hsa-miR-3654	CLIP-seq
MIRT2457098	hsa-miR-375	CLIP-seq
MIRT2599894	hsa-miR-380	CLIP-seq
MIRT2599895	hsa-miR-381	CLIP-seq
MIRT2599896	hsa-miR-3913-3p	CLIP-seq
MIRT2599897	hsa-miR-3925-5p	CLIP-seq
MIRT2457099	hsa-miR-4273	CLIP-seq
MIRT2599898	hsa-miR-4279	CLIP-seq
MIRT2599899	hsa-miR-4282	CLIP-seq
MIRT2457100	hsa-miR-4292	CLIP-seq
MIRT2457101	hsa-miR-4308	CLIP-seq
MIRT2599900	hsa-miR-4430	CLIP-seq
MIRT2599901	hsa-miR-4474-3p	CLIP-seq
MIRT2599902	hsa-miR-4495	CLIP-seq
MIRT2599903	hsa-miR-4505	CLIP-seq
MIRT2599904	hsa-miR-4525	CLIP-seq
MIRT2599905	hsa-miR-4662a-3p	CLIP-seq
MIRT2599906	hsa-miR-4664-3p	CLIP-seq
MIRT2599907	hsa-miR-4665-5p	CLIP-seq
MIRT2599908	hsa-miR-4666-3p	CLIP-seq
MIRT1259980	hsa-miR-4668-5p	CLIP-seq
MIRT1259981	hsa-miR-4677-5p	CLIP-seq
MIRT2599909	hsa-miR-4699-3p	CLIP-seq
MIRT2599910	hsa-miR-4723-5p	CLIP-seq
MIRT2599911	hsa-miR-4731-5p	CLIP-seq
MIRT2465902	hsa-miR-4753-3p	CLIP-seq
MIRT2599912	hsa-miR-4793-3p	CLIP-seq
MIRT2599913	hsa-miR-4803	CLIP-seq
MIRT2599914	hsa-miR-507	CLIP-seq
MIRT2599915	hsa-miR-518d-5p	CLIP-seq
MIRT2599916	hsa-miR-519b-5p	CLIP-seq
MIRT2599917	hsa-miR-519c-5p	CLIP-seq
MIRT2599918	hsa-miR-520c-5p	CLIP-seq
MIRT2599919	hsa-miR-526a	CLIP-seq
MIRT2599920	hsa-miR-543	CLIP-seq
MIRT2599921	hsa-miR-557	CLIP-seq
MIRT2599922	hsa-miR-577	CLIP-seq
MIRT1259988	hsa-miR-603	CLIP-seq
MIRT2599923	hsa-miR-625	CLIP-seq
MIRT2599924	hsa-miR-637	CLIP-seq
MIRT2599925	hsa-miR-641	CLIP-seq
MIRT2465901	hsa-miR-1236	CLIP-seq
MIRT2599877	hsa-miR-1275	CLIP-seq
MIRT2599878	hsa-miR-1287	CLIP-seq
MIRT2457097	hsa-miR-2117	CLIP-seq
MIRT2076573	hsa-miR-223	CLIP-seq
MIRT2599881	hsa-miR-3074-5p	CLIP-seq
MIRT2599882	hsa-miR-30a	CLIP-seq
MIRT2599883	hsa-miR-30b	CLIP-seq
MIRT2599884	hsa-miR-30c	CLIP-seq
MIRT2599885	hsa-miR-30d	CLIP-seq
MIRT2599886	hsa-miR-30e	CLIP-seq
MIRT2599887	hsa-miR-3123	CLIP-seq
MIRT2599888	hsa-miR-3135b	CLIP-seq
MIRT2599889	hsa-miR-3143	CLIP-seq
MIRT2599890	hsa-miR-3148	CLIP-seq
MIRT2599891	hsa-miR-3617	CLIP-seq
MIRT2457098	hsa-miR-375	CLIP-seq
MIRT2599894	hsa-miR-380	CLIP-seq
MIRT2599896	hsa-miR-3913-3p	CLIP-seq
MIRT2599897	hsa-miR-3925-5p	CLIP-seq
MIRT2457099	hsa-miR-4273	CLIP-seq
MIRT2599898	hsa-miR-4279	CLIP-seq
MIRT2457100	hsa-miR-4292	CLIP-seq
MIRT2457101	hsa-miR-4308	CLIP-seq
MIRT2599902	hsa-miR-4495	CLIP-seq
MIRT2599904	hsa-miR-4525	CLIP-seq
MIRT2599905	hsa-miR-4662a-3p	CLIP-seq
MIRT2599907	hsa-miR-4665-5p	CLIP-seq
MIRT1259980	hsa-miR-4668-5p	CLIP-seq
MIRT1259981	hsa-miR-4677-5p	CLIP-seq
MIRT2599909	hsa-miR-4699-3p	CLIP-seq
MIRT2599910	hsa-miR-4723-5p	CLIP-seq
MIRT2599911	hsa-miR-4731-5p	CLIP-seq
MIRT2465902	hsa-miR-4753-3p	CLIP-seq
MIRT2599912	hsa-miR-4793-3p	CLIP-seq
MIRT2599913	hsa-miR-4803	CLIP-seq
MIRT2599914	hsa-miR-507	CLIP-seq
MIRT2599915	hsa-miR-518d-5p	CLIP-seq
MIRT2599916	hsa-miR-519b-5p	CLIP-seq
MIRT2599917	hsa-miR-519c-5p	CLIP-seq
MIRT2599918	hsa-miR-520c-5p	CLIP-seq
MIRT2599919	hsa-miR-526a	CLIP-seq
MIRT2599920	hsa-miR-543	CLIP-seq
MIRT2599921	hsa-miR-557	CLIP-seq
MIRT2599922	hsa-miR-577	CLIP-seq
MIRT2599923	hsa-miR-625	CLIP-seq
MIRT2599924	hsa-miR-637	CLIP-seq
MIRT2599925	hsa-miR-641	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
CEBPB	Activation	19717648
PAX5	Repression	17682124;22593617
STAT3	Activation	1702555
STAT3	Unknown	12953803

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	1851123
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	TAS	1851123
GO:0000976	Function	Transcription cis-regulatory region binding	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	1851123
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IDA	1851123
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IEA
GO:0001701	Process	In utero embryonic development	IEA
GO:0001763	Process	Morphogenesis of a branching structure	IEA
GO:0001822	Process	Kidney development	IEA
GO:0001892	Process	Embryonic placenta development	IEA
GO:0001893	Process	Maternal placenta development	IEA
GO:0002250	Process	Adaptive immune response	IEA
GO:0002376	Process	Immune system process	IEA
GO:0003170	Process	Heart valve development	IEA
GO:0003279	Process	Cardiac septum development	IEA
GO:0003281	Process	Ventricular septum development	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IBA
GO:0003700	Function	DNA-binding transcription factor activity	TAS	1851123
GO:0005515	Function	Protein binding	IPI	22555612, 28842558, 32417234, 32814053
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	28842558
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005730	Component	Nucleolus	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	21421998
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0007281	Process	Germ cell development	IEA
GO:0008168	Function	Methyltransferase activity	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0009791	Process	Post-embryonic development	IEA
GO:0010467	Process	Gene expression	IEA
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0010629	Process	Negative regulation of gene expression	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0032259	Process	Methylation	IEA
GO:0032823	Process	Regulation of natural killer cell differentiation	IEA
GO:0032823	Process	Regulation of natural killer cell differentiation	ISS
GO:0033082	Process	Regulation of extrathymic T cell differentiation	IEA
GO:0033082	Process	Regulation of extrathymic T cell differentiation	ISS
GO:0035904	Process	Aorta development	IEA
GO:0042127	Process	Regulation of cell population proliferation	IEA
GO:0042462	Process	Eye photoreceptor cell development	IEA
GO:0045087	Process	Innate immune response	IEA
GO:0045165	Process	Cell fate commitment	IBA
GO:0045165	Process	Cell fate commitment	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0048844	Process	Artery morphogenesis	IEA
GO:0048869	Process	Cellular developmental process	IEA
GO:0051136	Process	Regulation of NK T cell differentiation	IEA
GO:0051136	Process	Regulation of NK T cell differentiation	ISS
GO:0060040	Process	Retinal bipolar neuron differentiation	IEA
GO:0060576	Process	Intestinal epithelial cell development	IEA
GO:0060707	Process	Trophoblast giant cell differentiation	IEA
GO:0060976	Process	Coronary vasculature development	IEA
GO:1990226	Function	Histone methyltransferase binding	IEA
GO:1990654	Process	Sebum secreting cell proliferation	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:1990841	Function	Promoter-specific chromatin binding	IEA
GO:1990841	Function	Promoter-specific chromatin binding	ISS

Other IDs

• MIM: 603423
• HGNC: 9346
• e!Ensembl: ENSG00000057657

Protein

• UniProt ID: O75626
• Protein name: PR domain zinc finger protein 1 (EC 2.1.1.-) (BLIMP-1) (Beta-interferon gene positive regulatory domain I-binding factor) (PR domain-containing protein 1) (Positive regulatory domain I-binding factor 1) (PRDI-BF1) (PRDI-binding factor 1)
• Protein function: Transcription factor that mediates a transcriptional program in various innate and adaptive immune tissue-resident lymphocyte T cell types such as tissue-resident memory T (Trm), natural killer (trNK) and natural killer T (NKT) cells and negativ
• PDB: 3DAL
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00856	SET	68 → 201	SET domain	Family
  PF00096	zf-C2H2	575 → 597	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	603 → 625	Zinc finger, C2H2 type	Domain
  PF13912	zf-C2H2_6	631 → 656		Domain

• Sequence:

  MLDICLEKRVGTTLAAPKCNSSTVRFQGLAEGTKGTMKMDMEDADMTLWTEAEFEEKCTY
  IVNDHPWDSGADGGTSVQAEASLPRNLLFKYATNSEEVIGVMSKEYIPKGTRFGPLIGEI
  YTNDTVPKNANRKYFWRIYSRGELHHFIDGFNEEKSNWMRYVNPAHSPREQNLAACQNGM
  NIYFYTIKPIPANQELLVWYCRDFAERLHYPYPGELTMMNLTQTQSSLKQPSTEKNELCP
  KNVPKREYSVKEILKLDSNPSKGKDLYRSNISPLTSEKDLDDFRRRGSPEMPFYPRVVYP
  IRAPLPEDFLKASLAYGIERPTYITRSPIPSSTTPSPSARSSPDQSLKSSSPHSSPGNTV
  SPVGPGSQEHRDSYAYLNASYGTEGLGSYPGYAPLPHLPPAFIPSYNAHYPKFLLPPYGM
  NCNGLSAVSSMNGINNFGLFPRLCPVYSNLLGGGSLPHPMLNPTSLPSSLPSDGARRLLQ
  PEHPREVLVPAPHSAFSFTGAAASMKDKACSPTSGSPTAGTAATAEHVVQPKATSAAMAA
  PSSDEAMNLIKNKRNMTGYKTLPYPLKKQNGKIKYECNVCAKTFGQLSNLKVHLRVHSGE
  RPFKCQTCNKGFTQLAHLQKHYLVHTGEKPHECQVCHKRFSSTSNLKTHLRLHSGEKPYQ
  CKVCPAKFTQFVHLKLHKRLHTRERPHKCSQCHKNYIHLCSLKVHLKGNCAAAPAPGLPL
  EDLTRINEEIEKFDISDNADRLEDVEDDISVISVVEKEILAVVRKEKEETGLKVSLQRNM
  GNGLLSSGCSLYESSDLPLMKLPPSNPLPLVPVKVKQETVEPMDP

• Sequence length: 825

Pathways

Reactome:

Regulation of TP53 Expression

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ANDROGENETIC ALOPECIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANKYLOSING SPONDYLITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, RHEUMATOID	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC LEFT-SIDED ULCERATIVE COLITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLITIS, ULCERATIVE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUPUS ERYTHEMATOSUS, SYSTEMIC	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRDM1-related disorder	Likely benign; Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCLEROSING CHOLANGITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SICCA SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SJOGREN'S SYNDROME	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SJOGRENS SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	22438909		★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	16492805, 16585013, 17213024, 17291741, 17379744, 19380033		★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	18583325, 21785431, 26530011		★☆☆☆☆ Found in Text Mining only
Aggressive Periodontitis	Aggressive Periodontitis	BEFREE	25263394		★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	26472169		★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	GWASCAT_DG	26974007		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	28790031		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	29599140		★☆☆☆☆ Found in Text Mining only
Arthralgia	Arthralgia	Pubtator	29720240	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	29720240	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	19898481	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	29720240	Stimulate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	29599140		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	26376898, 28692065, 28701508, 28732506, 29291257, 30498131, 30540578, 30672908, 31168760		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	12165517, 15772984, 17213024, 19380033, 20966935, 26625717, 27436361, 28474779, 28849038, 28875978, 29131072, 29781221, 31025923, 8921366		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	LHGDN	16424392, 16585013, 17213024		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	22438909, 23054396, 28378641, 28442738		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	19433448, 34907035	Associate	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	25382611		★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	25382611	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	28468592	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	24162662		★☆☆☆☆ Found in Text Mining only
Carcinoma Embryonal	Embryonal carcinoma	Pubtator	18992153	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	35382824	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	22438909, 28378641		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	27144525, 35308143	Associate	★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	25233927		★☆☆☆☆ Found in Text Mining only
Cholangitis, Sclerosing	Cholangitis	GWASCAT_DG	26974007		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	21998751, 24637363, 30654767		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	31100710		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	27105524, 30692620		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	29760071, 31396355		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	29760071		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	29760071	Inhibit	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	28675510, 29760071	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	32393998	Stimulate	★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common variable immunodeficiency	Pubtator	33463110	Stimulate	★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common variable immunodeficiency	Pubtator	34920653	Associate	★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	18992913		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	23624108		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	23624108	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	GWASCAT_DG	26974007		★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	32998701	Associate	★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	15772984, 16424392, 16492805, 16585013, 17213024, 17291741, 17379744, 18297524, 18583325, 19380033, 20047096, 20651244, 21722313, 25115512, 25382611, 26530011, 27568520, 28474779		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	28300844	Associate	★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	30105896		★☆☆☆☆ Found in Text Mining only
GATA2 Deficiency	Gata2 deficiency	Pubtator	21690554, 22143801, 22922206, 25203537, 28468592, 32732362	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	28378641		★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	35572579	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	15772984, 18583325, 21785431, 26530011		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	18583325, 25232062	Inhibit	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	21785431, 23089009, 24306881, 26530011	Associate	★☆☆☆☆ Found in Text Mining only
Immunoglobulin A deficiency (disorder)	Immunoglobulin A deficiency	BEFREE	19735688		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	23028907, 24487271, 25826676, 26376898		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	23028907, 24487271	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	GWASCAT_DG	26192919		★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	24004669		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	17374122	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	8921366		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	19666867, 28629373	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	28629373		★☆☆☆☆ Found in Text Mining only
Libman-Sacks Disease	Nonbacterial verrucal endocardiosis	CTD_human_DG	19838195		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	31100710, 31376415		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	31100710		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	12557265		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	22116829, 23911415		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	19838195	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	22116829, 23911415		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	19838195, 21622776, 22116829, 23911415, 28097234		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus, Systemic	Lupus Erythematosus	CTD_human_DG	19838195		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Vulgaris	Lupus Vulgaris	BEFREE	22116829, 23911415		★☆☆☆☆ Found in Text Mining only
Lymphedema	Lymphedema	Pubtator	11841448	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	10508273, 17379744, 19828640, 25115512, 26530011, 28378641, 28842558		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	LHGDN	17379744, 18596541		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	17379744, 19828640, 25991819, 32985591, 37657032	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	22102710, 30348636	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma Primary Cutaneous Anaplastic Large Cell	Primary cutaneous anaplastic large cell lymphoma	Pubtator	34382383	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	30348636		★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative Disorder	BEFREE	21156281		★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	BEFREE	20530581		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	22438909, 23054396, 28378641, 28442738		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	22438909, 23690269, 28378641		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	28790031		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	20047096, 22143801, 25382611, 26823144, 28378641, 28468592, 28474779, 28790031, 31666930, 31741141, 8921366		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	29760071, 31396355		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	19433448, 23054396		★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	20530581		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	12453881, 16002735, 18192112, 22723553, 25987254, 26823144		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	12453881, 16765445, 17300840, 25743686, 26823144, 28052011, 29654271, 29789651, 32070879, 32765503, 32985591, 37452600	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	LHGDN	17043021		★☆☆☆☆ Found in Text Mining only
Nasal Type Extranodal NK/T-Cell Lymphoma	Extranodal NK T Cell Lymphoma	BEFREE	24438193, 26221594, 27704586, 31002364		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	25410866	Stimulate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	28179525		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10688904, 15772984, 16424392, 16492805, 16585013, 18583325, 18596541, 19073176, 20047096, 20651244, 21156281, 21690554, 21722313, 22143801, 22438909, 23599149, 24004669, 24438193, 25115512, 25203537, 25382611, 26212250, 26530011, 28378641, 28468592, 28474779, 28494239, 29760071, 29966370, 31002364, 31396355, 8921366		★☆☆☆☆ Found in Text Mining only
Neuromyelitis Optica	Neuromyelitis Optica	BEFREE	18410276		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	23690269, 25635434		★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	31024321		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	28790031		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	25263394		★☆☆☆☆ Found in Text Mining only
Primary amyloidosis	Amyloidosis	BEFREE	21894172		★☆☆☆☆ Found in Text Mining only
Primary central nervous system lymphoma	Central Nervous System Lymphoma	BEFREE	18596541		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	GWASCAT_DG	26974007		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pyoderma Gangrenosum	Pyoderma Gangrenosum	BEFREE	24487271		★☆☆☆☆ Found in Text Mining only
Pyoderma Gangrenosum	Pyoderma gangrenosum	Pubtator	24487271	Associate	★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	14656887, 8921366		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	CTD_human_DG	19898481, 20453842, 23143596		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	22040493, 25263394, 31019190		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Selective immunoglobulin A deficiency	Selective Immunoglobulin A Deficiency	BEFREE	19735688		★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	Pubtator	18992153	Associate	★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	BEFREE	21564135		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	28723546		★☆☆☆☆ Found in Text Mining only
Sicca Syndrome	Sjogren`s Syndrome	CTD_human_DG	24097067		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sjogren's Syndrome	Sjogren syndrome	Pubtator	35896530	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sjogren`s Syndrome	Sjogren`s Syndrome	CTD_human_DG	24097067		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	30197274		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	25410866	Stimulate	★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	16585013, 18235046, 20047096, 24004669, 24438193, 25115512, 28468592, 29760071		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	36930113	Associate	★☆☆☆☆ Found in Text Mining only
Truncus Arteriosus, Persistent	Persistent truncus arteriosus	BEFREE	25713110		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	GWASCAT_DG	21297633, 26974007		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ulcerative Colitis	Ulcerative colitis	GWASDB_DG	21297633		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ulcerative Colitis	Ulcerative colitis	CTD_human_DG	21297633		★★☆☆☆ Found in Text Mining + Unknown/Other Associations